(data stored in ACNUC7421 zone)

EMBL: CP000690.PE91

CP000690.PE91        Location/Qualifiers
FT   CDS_pept        complement(104254..104646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28995"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR3"
FT                   /protein_id="ABQ28995.1"
FT                   /translation="MLRTNARVTPLQAVIRYRDLLEVEALFRAAKASFDTRPIFHQADA
FT                   AIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEKGGKVITTRTH
FT                   VTGQVGNVFKAASIALPHNISEHPAD"
     gtgctcagga ccaacgcaag ggtcacgccc ctgcaggccg tgatccggta tcgcgacctg        60
     ctcgaggtcg aggccctgtt ccgcgccgcc aaggccagct tcgatacaag gccgatcttt       120
     caccaggctg acgccgcgat ccgcggccac gttttctgtt ccttcctggc cctgacactc       180
     gccaaggaac tgaaccgcct gtgcggcgcc aggggcttcc agcccgaatg gcagaagttg       240
     ctgaacgatc tcgacaggct ccagcaggca accatcgaaa agggcggcaa ggtcatcacc       300
     acgaggaccc acgtcaccgg ccaggtcggc aatgtcttca aggccgccag catcgcgctg       360
     ccccacaaca tcagcgaaca ccccgcagac tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page