(data stored in ACNUC7421 zone)

EMBL: CP000690.PE94

CP000690.PE94        Location/Qualifiers
FT   CDS_pept        complement(106903..107499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28998"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR6"
FT                   /protein_id="ABQ28998.1"
FT                   /translation="MHDQFACSCRFRVLNIVERRVMTSTTARAQQAPGEKIRRFKEFND
FT                   GAASWDRVERIIARVEAWPLGGDTRFIVTSLKAGSPRTLYQEIYCARGQAENHIKAWKT
FT                   NLAADRTSCSRASANQMRLFLHIGAYWLMWSFRSLMPRRSRWRGIQFNTLHLRLIKLAV
FT                   RLETLKRSIRMHLPRSMPDQAILGYAPARLPRLVS"
     gtgcacgacc agttcgcctg cagctgtcgg ttccgcgtgc tgaacatcgt cgagcgccgg        60
     gtcatgacca gcaccacggc gcgcgcgcaa caggctccgg gagagaaaat ccggcggttc       120
     aaagagttca atgatggcgc agcaagctgg gaccgcgtcg agcggatcat cgcccgcgtc       180
     gaggcctggc cgctgggggg cgatacccgc ttcatcgtca ccagcctgaa ggctggttcc       240
     ccgcgcaccc tgtatcaaga gatctactgc gcgcgcggcc aggccgagaa ccatatcaag       300
     gcgtggaaga ccaatcttgc ggccgaccgg acctcgtgct cgcgggccag cgccaaccag       360
     atgcgcctgt ttctgcatat cggcgcctac tggctgatgt ggagttttcg ctccctgatg       420
     ccgcgtcggt cgcgctggcg tggtatccag ttcaataccc tgcacctgcg cctgatcaaa       480
     ctcgccgtcc gcctcgaaac cctgaaacgc tcgatccgca tgcatctgcc gcgctcaatg       540
     ccggaccagg caatcctcgg ctatgccccg gccagactgc ccaggctggt cagctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page