(data stored in ACNUC7421 zone)

EMBL: CP000690.PE95

CP000690.PE95        Location/Qualifiers
FT   CDS_pept        109594..111663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3392"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28999"
FT                   /db_xref="GOA:A5FTR7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR7"
FT                   /protein_id="ABQ28999.1"
FT                   /translation="MHEKIGPHHLERKALLYVRQSSAHQVLHNRESSALQYAMRDRLTV
FT                   LGWSSIETIDDDLGRSAAGGVTRAGFDRMVAEVCLGKVGAVAAREVSRFARNSRDWQQL
FT                   IEMCRVVDTVLIDQETVYAPRQSNDRLLLGLKGSLNEYELDLLRQRSLSARYEKARRGE
FT                   LLVAAPVGFMKAGDRLEKDPDRRVQEAITLVFDKVAELGSARQALLWFLEHSLDLPARR
FT                   ANGDVVWRRPTYATIHRMIENPVYGGAYAYGKTRVTPRHDAIVPRSSSRRKRRGDWLAL
FT                   KPGAHEGYVSWERAEAIRTMVSDNIPASRHHGAPKHGDALLAGLLRCRRCGRKLTVRYT
FT                   GTNHNIPRYSCWRGLLDNGEPRCIAFGGLRVDDAIEEALLRVVEPGAIAAAAAAEAQAA
FT                   GRRDQVREALVRDLEAARYQADRAFRQYDAADPANRLVAAELETRWNRALAQAAEVEAR
FT                   IAEHDAAAPNSSSLAVLDAARLGTNLRAVWAAPTTDSRLKKRIVRTVIHEVVADIDDTA
FT                   SEIVLLVHWIGGAHTELRLPTRRRGQRNSTASEIIAAVRHLALIASDDLIAGILNRNRL
FT                   LTGHGNRWTRERVTALRSHHKIQVFRPAPDGIEPQLNLTDAARLLGVAPKTLRLAAEAG
FT                   VIEGDHPLPDGPWIFRRSELAKPAAAQITHRARQNPKHPAGSHPDQKNLSLSTT"
     atgcatgaga agatcggacc gcatcatctg gagcgcaaag cgctcctcta tgtgcggcaa        60
     tcctcggcgc atcaggtgct gcacaaccgc gagagcagcg ccctgcaata tgcgatgcgc       120
     gaccggctca cggtgctcgg ctggtcctcc atcgagacca tcgacgatga tcttggccgc       180
     tcggcggcgg gcggcgttac acgggccggc ttcgaccgga tggtggccga ggtttgcctg       240
     gggaaagtcg gtgcagttgc ggcgcgcgag gtctcccgct tcgcccgcaa cagccgcgac       300
     tggcagcagt tgatcgagat gtgccgggtc gtcgacaccg tcctgatcga ccaggagacg       360
     gtctatgcgc cacgccagag caacgaccgt ttgcttctcg gcctgaaggg cagcctcaac       420
     gagtacgagc tcgatcttct gcggcagcgc tcgctgtcgg cccgatacga gaaggcccgc       480
     cgcggcgagt tgctcgtcgc tgccccggtc ggcttcatga aggccggcga caggctggag       540
     aaggaccccg atcgccgcgt gcaggaggcc attactctcg tcttcgacaa ggtggctgag       600
     ctcggcagcg cccgacaggc tctgctctgg ttcctggagc acagtctgga tctgccggcc       660
     cgacgcgcca atggcgatgt ggtctggcgc aggccgacct acgccaccat ccaccgcatg       720
     atcgagaacc cggtctacgg cggcgcctac gcctatggta agactcgcgt gacgccgcgg       780
     cacgacgcga tcgttccgcg atccagcagt cgtcgcaagc ggcgcggcga ctggctggcg       840
     ctgaagccag gggcgcatga aggctatgtt agttgggaac gggcagaggc gatccgcacg       900
     atggtcagcg acaacatccc tgcgagccgg catcacggag cgcccaagca tggcgatgct       960
     ttgctggccg gcctgctgcg ttgccggcgc tgtggccgca agctgacggt ccgttatact      1020
     gggaccaatc acaatatccc ccgctattcc tgctggcggg gcctgctcga caatggcgag      1080
     ccgcgctgca tcgctttcgg cggcctgcgg gtcgacgacg ccatcgagga ggcattgctg      1140
     cgggtcgtgg aacccggcgc catcgccgcc gccgccgccg cagaggcgca agctgccggc      1200
     cggcgagacc aggtgcgcga ggctctggtg cgcgatctcg aagcggcccg ctaccaggcc      1260
     gatcgggcat tccggcaata tgacgccgct gatcctgcga accggcttgt tgccgcggag      1320
     ctggagacgc gatggaaccg cgccctcgcg caggccgccg aggtcgaggc aaggattgcc      1380
     gagcacgatg ccgccgcccc aaattcgtct tccctggcgg tgctcgacgc cgccaggctt      1440
     ggtacgaacc ttcgggcggt ctgggcggcg ccgacaacgg attcccggct caagaagcgt      1500
     atcgtccgca ccgtcatcca tgaagtggtt gccgatatcg atgacacagc ctccgagatc      1560
     gttctgctgg tccactggat tggcggtgcc cacacagagc ttcgcctgcc gacgcggcgc      1620
     cgcggacagc gcaacagcac ggcctccgag atcatcgccg cggtgcgcca tctcgcgctc      1680
     atcgcctccg acgacctgat tgctggcatc ctcaatcgga accgcctgct gaccggccat      1740
     ggcaaccgct ggacccgcga gcgggtcaca gccctccgtt cgcatcacaa gatccaggtc      1800
     ttccgccccg cgcccgacgg catcgaacct cagctcaacc ttaccgatgc cgcacgcctc      1860
     cttggcgtgg cgcccaagac cctcaggctc gccgccgagg ccggagtgat cgagggcgac      1920
     caccctttgc ccgacggccc gtggatcttc cgccggtccg aactcgccaa gccagccgcc      1980
     gcgcagatca ctcatcgcgc acggcagaac cccaaacacc ccgcgggatc acaccccgat      2040
     cagaaaaacc tatccctctc aacaacatag                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page