(data stored in ACNUC7421 zone)

EMBL: CP000690.PE96

CP000690.PE96        Location/Qualifiers
FT   CDS_pept        complement(111675..112499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3393"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29000"
FT                   /db_xref="GOA:A5FTR8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR8"
FT                   /protein_id="ABQ29000.1"
FT                   /translation="MAPGRLLYKGERGGPFHKILAPSHKREAVAHLQSLFEVSQRRACD
FT                   ALGVDRTTVRYQSRRPDDAEARERIRVLAGERRRFGYRRLHWLLSREGISMNHKKFRRL
FT                   YREERLQVRRRGGRKRALGTRSPMTIPQGCNQRWSLDFVSDALTCGRRFRIFAVVDDFS
FT                   RECVRLIADTSISGARLARELDMAITERGARPLMVVSDDGTELTSMSILRWSKERNVEW
FT                   HYIAPGKPQQNGFVESFNARLRDECLNETLFTSLPQARSVLAAWRHDYNPVS"
     ttggcccccg gcagattact ctacaagggg gaaaggggcg ggccattcca taaaattcta        60
     gcgcccagcc ataagcggga ggcggtagct catcttcaga gcctgttcga ggtgagccaa       120
     cgccgggcct gcgatgcgct gggcgtggat cggaccacgg tgcggtatca aagccgccgc       180
     ccggatgatg cggaggctcg cgaacgcatt cgcgtgcttg cgggcgagcg ccgtcgattt       240
     ggctatcggc gcctgcactg gctgctcagc cgcgaaggaa tttccatgaa ccacaagaag       300
     tttcggcgcc tttaccgcga agaacgcctt caggttcgcc gtcgcggcgg gcgaaagcgg       360
     gccttgggca cacgatctcc gatgaccatt ccgcagggct gcaatcagcg ctggtcgctg       420
     gatttcgtct ccgacgccct gacatgtggg cgcaggtttc gcatcttcgc cgtcgtggac       480
     gatttcagcc gcgaatgcgt tcgcttgatc gccgacacgt caatttcggg cgcccggctg       540
     gcacgcgagt tggatatggc gatcactgag cgcggggcgc gcccgctcat ggtggtcagc       600
     gacgacggca ctgagctcac cagcatgtcg atcctgcgct ggtcgaaaga gcggaacgtg       660
     gaatggcatt acatcgcgcc cggcaagccc cagcaaaacg ggttcgtcga gagcttcaac       720
     gcccggctcc gggacgagtg tctgaacgag accttgttca cgagcctgcc tcaagcgagg       780
     tccgtgctgg ccgcctggcg tcacgactac aatcctgttt cataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page