(data stored in ACNUC7421 zone)

EMBL: CP000690.PE97

CP000690.PE97        Location/Qualifiers
FT   CDS_pept        112521..113435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3394"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29001"
FT                   /db_xref="GOA:A5FTR9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR9"
FT                   /protein_id="ABQ29001.1"
FT                   /translation="MKTEIAVLGIDLGKNSCSLAGLDGTGAVIKRRRMRPETVVTFTKE
FT                   LPPCVIAMEACCGAHHLARLLAAQGHDVRLMSPEYVRPYVKAQKNDDRDAEAIAEAATR
FT                   PTMRFVSMKTEEQLDMQTLHRARDRLVGERTALINQLRAILLERGVTVPQGRSKLERSL
FT                   IEMFDGDEAEPPATLTPRLRALIADMRAEWRELDRRITAFEDEFVARTREDEAARRLIS
FT                   IPGIGVMNATALIAAIGNGETFSRGRDLAAWLGLVPRQITTGGRPRLVGISKRGNKYLR
FT                   KLLIHGARAALPSLLTSSTPLGG"
     atgaagacag agatcgcggt tttagggatt gatctgggca agaacagctg cagccttgcg        60
     ggactggatg ggactggtgc ggtgatcaaa cggcggcgga tgcgaccgga gaccgtggtg       120
     acgttcacga aggagttgcc gccttgcgtg atagcgatgg aggcgtgctg cggcgctcat       180
     catcttgccc gtcttctcgc ggcgcaggga cacgacgtcc ggctgatgtc gccggaatac       240
     gtgcgccctt atgtgaaggc gcagaagaac gatgatcgcg atgccgaggc gattgcggag       300
     gcggcaacac ggccgacgat gcgttttgtg tccatgaaaa cggaggagca gcttgacatg       360
     cagaccctgc atcgggcgcg tgaccggctg gtcggtgaac ggacggcgct gatcaaccag       420
     ctgcgagcga tcctgttgga gcgcggggtt acggtgccgc aggggcggag caagctcgag       480
     cggtccctga tcgagatgtt cgatggcgat gaagccgagc caccggcgac attgacgccg       540
     cggctgcggg cgctgattgc cgacatgcgg gccgaatggc gtgagctgga tcggcggatc       600
     accgcttttg aggacgaatt tgtcgctcgc acgcgcgagg acgaagcggc acgccggctg       660
     atcagcattc ccgggatcgg cgtgatgaac gcgaccgcgc tgattgccgc gatcggcaac       720
     ggtgagacgt tcagccgggg ccgcgatctt gctgcctggc ttggtctggt gccgcggcag       780
     atcacgacag gaggccgacc gcggctggtc gggatcagca agcgcggcaa caagtatctg       840
     cgcaagctgc tgatccatgg tgctcgcgcc gctcttccca gtctgttgac cagctcaacg       900
     ccgctcggcg gctag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page