(data stored in ACNUC7421 zone)

EMBL: CP000690.PE98

CP000690.PE98        Location/Qualifiers
FT   CDS_pept        complement(113781..114083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3395"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29002"
FT                   /db_xref="GOA:A5FTS0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS0"
FT                   /protein_id="ABQ29002.1"
FT                   /translation="MKSSRFSEEQIIGILKEQESGMSTAEVCRRHGISSATFYKWKAKF
FT                   GGLEVSDARRLKQLEDENARLKRLLADAVLDNAMLKEIASKTYGPPRLQVVFSMN"
     atgaagagca gtcggtttag cgaggaacag atcatcggca tcctcaaaga gcaggagtcg        60
     gggatgtcga cggcggaggt ctgccgtcga cacgggatca gttcggcgac gttttacaag       120
     tggaaggcca aattcggcgg gttggaagtc tcggacgccc ggcggctcaa acagctggaa       180
     gacgagaacg ctcggctcaa gcggctgttg gcggacgccg tgctggacaa cgccatgctc       240
     aaggaaattg cgtcaaaaac gtatggcccg ccccgtctgc aagtggtatt ttcgatgaac       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page