(data stored in ACNUC7421 zone)

EMBL: CP000690.PE99

CP000690.PE99        Location/Qualifiers
FT   CDS_pept        complement(114946..115974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3396"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29003"
FT                   /db_xref="GOA:A5FTS1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS1"
FT                   /protein_id="ABQ29003.1"
FT                   /translation="MARVLVTGGTGFLGAHCIIQLLAAGHEVRATVRDLRRKDAVEAML
FT                   RQGGAEITTDQVALFAADLTADAGWNEAIANCDYILHVASPYPRSIPKDENELIRPARD
FT                   GTLRVLRVARDANVKRVVLTSSFAAIGYGNGHTGIFTENDWTDPDDPTIQPYQRSKTLA
FT                   ERAAWAFMNREGGALELAVVNPTGILGPLLGPDLSTSIHLIKRMMEGSTPGCPDLWFGV
FT                   LDARDAADLHLRAMTDPAAAGERFLATAGHFMSVTQVAQTLKDRLGNAACAVSTRQLPN
FT                   WLLRAAALFDPEVRPLLPELGKRKNATAAKAQRLLGWTPRSPEDAIIATATSLVELKLL
FT                   KS"
     atggcacggg ttctggtgac gggcggcaca gggtttctgg gcgcgcattg catcatccaa        60
     ctgctcgcgg cggggcacga ggtccgagcc acggtgcggg atctacggcg gaaggacgcc       120
     gtagaggcca tgctgcgaca aggcggagcg gaaattacca ccgatcaggt tgctcttttc       180
     gctgcggacc tcactgccga cgcgggctgg aacgaagcca tcgctaactg cgattatata       240
     ctccatgtcg catctcccta tcctcgtagt attcccaaag acgagaatga attaatcaga       300
     cctgcaaggg acgggacgct ccgggtctta agggtagcac gcgatgccaa tgtgaagcgg       360
     gtggtgctca cgtcgtcgtt cgcggcgatc ggatatggca acgggcatac ggggatattc       420
     acagaaaatg actggactga tcccgacgat ccgacgatcc agccctatca gagatccaaa       480
     acgctggccg agcgcgccgc gtgggcgttc atgaaccgcg aaggcggtgc gctggaactc       540
     gcggttgtca atccgaccgg catccttggc ccactactag ggcctgacct gtcgacgtcg       600
     atccatttga taaagcggat gatggaaggc agcacaccgg gatgccccga cctgtggttc       660
     ggcgtcttgg atgcccgcga cgccgcggat ctccatctcc gggcaatgac cgatcccgcc       720
     gcagccgggg agcgattcct tgcgaccgca ggacatttca tgagcgttac tcaagtggct       780
     cagaccttga aggaccgtct tggcaacgct gcctgcgccg tatccacgcg ccaattgccg       840
     aactggctgt tgcgcgcagc tgcattattc gatcccgaag tgcggccctt gttgcccgag       900
     cttggcaaac gcaagaacgc gactgccgcc aaggcgcagc gcctgcttgg ctggactccg       960
     cgatcccctg aggacgcgat tatcgccaca gcgaccagcc tcgtggaact caaactgctc      1020
     aaatcctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page