(data stored in ACNUC1104 zone)

EMBL: CP000717.PE1

CP000717.PE1         Location/Qualifiers
FT   CDS_pept        102..1625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10001"
FT                   /old_locus_tag="TBFG_00001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /note="Mapped to H37Rv Rv0001"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04344"
FT                   /protein_id="ABR04344.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPHNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
     ttgaccgatg accccggttc aggcttcacc acagtgtgga acgcggtcgt ctccgaactt        60
     aacggcgacc ctaaggttga cgacggaccc agcagtgatg ctaatctcag cgctccgctg       120
     acccctcagc aaagggcttg gctcaatctc gtccagccat tgaccatcgt cgaggggttt       180
     gctctgttat ccgtgccgag cagctttgtc caaaacgaaa tcgagcgcca tctgcgggcc       240
     ccgattaccg acgctctcag ccgccgactc ggacatcaga tccaactcgg ggtccgcatc       300
     gctccgccgg cgaccgacga agccgacgac actaccgtgc cgccttccga aaatcctgct       360
     accacatcgc cagacaccac aaccgacaac gacgagattg atgacagcgc tgcggcacgg       420
     ggcgataacc agcacagttg gccaagttac ttcaccgagc gcccgcacaa taccgattcc       480
     gctaccgctg gcgtaaccag ccttaaccgt cgctacacct ttgatacgtt cgttatcggc       540
     gcctccaacc ggttcgcgca cgccgccgcc ttggcgatcg cagaagcacc cgcccgcgct       600
     tacaaccccc tgttcatctg gggcgagtcc ggtctcggca agacacacct gctacacgcg       660
     gcaggcaact atgcccaacg gttgttcccg ggaatgcggg tcaaatatgt ctccaccgag       720
     gaattcacca acgacttcat taactcgctc cgcgatgacc gcaaggtcgc attcaaacgc       780
     agctaccgcg acgtagacgt gctgttggtc gacgacatcc aattcattga aggcaaagag       840
     ggtattcaag aggagttctt ccacaccttc aacaccttgc acaatgccaa caagcaaatc       900
     gtcatctcat ctgaccgccc acccaagcag ctcgccaccc tcgaggaccg gctgagaacc       960
     cgctttgagt gggggctgat cactgacgta caaccacccg agctggagac ccgcatcgcc      1020
     atcttgcgca agaaagcaca gatggaacgg ctcgcggtcc ccgacgatgt cctcgaactc      1080
     atcgccagca gtatcgaacg caatatccgt gaactcgagg gcgcgctgat ccgggtcacc      1140
     gcgttcgcct cattgaacaa aacaccaatc gacaaagcgc tggccgagat tgtgcttcgc      1200
     gatctgatcg ccgacgccaa caccatgcaa atcagcgcgg cgacgatcat ggctgccacc      1260
     gccgaatact tcgacactac cgtcgaagag cttcgcgggc ccggcaagac ccgagcactg      1320
     gcccagtcac gacagattgc gatgtacctg tgtcgtgagc tcaccgatct ttcgttgccc      1380
     aaaatcggcc aagcgttcgg ccgtgatcac acaaccgtca tgtacgccca acgcaagatc      1440
     ctgtccgaga tggccgagcg ccgtgaggtc tttgatcacg tcaaagaact caccactcgc      1500
     atccgtcagc gctccaagcg ctag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page