(data stored in ACNUC1104 zone)

EMBL: CP000717.PE102

CP000717.PE102       Location/Qualifiers
FT   CDS_pept        110135..117673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10102"
FT                   /old_locus_tag="TBFG_00101"
FT                   /product="peptide synthetase nrp"
FT                   /note="Mapped to H37Rv Rv0101"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10102"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04445"
FT                   /protein_id="ABR04445.1"
FT                   /translation="MHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAA
FT                   LHATVLDNPVQLCVLENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVR
FT                   HTVHTDPNGYVTGLDVHTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLRE
FT                   AHRRETAKVEESRGRLSAVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNA
FT                   FDAILTLSEAQRVPLNVLVAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVN
FT                   SVAQTVRFPPFASVSDVVRTLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNF
FT                   IREPCAPGLRPFLSEVPIATDIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPK
FT                   VAERIAAALESMAAMWDRPIAMIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDSARGV
FT                   HQFLGRRRFVYPWVAWLVQRGAAPGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTAD
FT                   EISVRTNAITEHGDGILVTVVDVAATQLAVVGHDELRKVVDERVTQVTHDALLATKTAY
FT                   IMPTSGTTGQPKLVRISHGSLAVFCDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGA
FT                   ACGARLVRSAAMKTGDLAALVDDLVARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQ
FT                   IVIGGEAIRCSAVDKWLESAASQGISLLSSYGPTEATVVATFLPIVCDQTTMDGALLRL
FT                   GRPILPNTVFLAFGEVVIVGDLVADGYLGIDGDGFGTVTAADGSRRRAFATGDRVTVDA
FT                   EGFPVFSGRKDAVVKISGKRVDIAEVTRRIAEDPAVSDVAVELHSGSLGVWFKSQRTRE
FT                   GEQDAAAATRIRLVLVSLGVSSFFVVGVPNIPRKPNGKIDSDNLPRLPQWSAAGLNTAE
FT                   TGQRAAGLSQIWSRQLGRAIGPDSSLLGEGIGSLDLIRILPETRRYLGWRLSLLDLIGA
FT                   DTAANLADYAPTPDAPTGEDRFRPLVAAQRPAAIPLSFAQRRLWFLDQLQRPAPVYNMA
FT                   VALRLRGYLDTEALGAAVADVVGRHESLRTVFPAVDGVPRQLVIEARRADLGCDIVDAT
FT                   AWPADRLQRAIEEAARHSFDLATEIPLRTWLFRIADDEHVLVAVAHHIAADGWSVAPLT
FT                   ADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQREILGDLDDSDSPIAAQLAYWENALAG
FT                   MPERLRLPTARPYPPVADQRGASLVVDWPASVQQQVRRIARQHNATSFMVVAAGFAVLL
FT                   SKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVLRVNLAGDPSFAELLGQVRARSLA
FT                   AYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDNPVGQLNLGDLQATPMPIDTRTA
FT                   RMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAIDVLIERLRKVLVAVAAAPERTV
FT                   SSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAAQVARIPEAEAVCCGDASMTY
FT                   RELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMVAVLKTGAAYLPIDPANPPP
FT                   RVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAYPGTPPPMPAAVNLAYILY
FT                   TSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYGFDASAWEIWGALLGGGR
FT                   LVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLESVALVVAGEACPAALV
FT                   DRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGAALFVLDSWLRPVPAG
FT                   VAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDLVCWRADGQLEFLGR
FT                   TDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVGYATEIAPGAVDPA
FT                   GLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTNGYRAPAGPVEKT
FT                   VAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVRALLHASSTRGL
FT                   SQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNLPGPSPELRTV
FT                   LLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSGDPELLRHFK
FT                   ELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHELFGPNVAGT
FT                   AELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWAGGYGTSK
FT                   WAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATGIAPRSF
FT                   YEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGIGLDEY
FT                   VDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPLKPTR
FT                   GCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL"
     gtgcaccgag ttcggttaag ccgctcgcag cgcaacctct acaacggcgt gcgccaggat        60
     aacaatcccg cgttatatct gatcggcaag agctatcggt tccgccggtt ggagctggcg       120
     agattcctgg ccgctctgca cgcaacggta ctggacaacc ccgtgcaact ttgcgtcctg       180
     gagaattcgg gggcagacta tccggatctg gtgccgcggc tacggttcgg cgacatcgtg       240
     cgggtggggt cagccgatga gcacctgcag agcacatggt gttcgggcat cctgggcaag       300
     ccactggtgc ggcatacggt gcacaccgac ccgaacgggt atgtgaccgg tctggacgtt       360
     cacacccacc acatcctgct ggacggcggc gcgaccggga cgatcgaagc tgacctggcg       420
     cgttacctga ccaccgaccc ggcgggcgaa acccccagtg tcggtgcggg tctagccaag       480
     ctcagggagg cgcaccgtcg tgagacggcc aaggtggaag aatcgcgggg gcgcctgtcg       540
     gctgtcgtgc agcgtgaact cgccgacgaa gcataccacg gcgggcacgg gcacagcgtt       600
     agcgacgctc ccgggaccgc ggccaagggc gtcctgcacg aatcggcaac gatctgcggc       660
     aacgcgtttg atgccatcct gaccctttcg gaagcgcagc gggtcccgct taatgtgctg       720
     gtggctgcgg cggccgtcgc ggtggacgcg agccttcggc agaacaccga aaccctcttg       780
     gtgcacacgg tggacaaccg gttcggagat tctgatctga atgtcgcgac ctgtttggtc       840
     aattcggttg cccagaccgt ccggtttccc ccatttgcgt cggtgtccga tgtcgttcga       900
     acgcttgacc gcggctatgt caaggcggta agacgccggt ggcttcgtga ggagcattac       960
     cgccgaatgt atttggcgat caaccggaca tctcacgtgg aggcgttgac gctaaatttc      1020
     attcgcgagc catgcgcacc tggcctgcgc ccgttcttgt cggaggtccc gattgccacg      1080
     gatatcggtc cggtcgaggg catgacggtg gcgtctgttc tggacgaaga acagcgcaca      1140
     ctgaacctag ccatctggaa ccgagccgat ctgcccgcgt gcaagacaca ccccaaggtc      1200
     gcggaacgga tagcggcagc gttggaatcg atggcggcga tgtgggatcg gccgatcgcc      1260
     atgatcgtca acgactggtt cgggatcggc ccggacggga ctcgctgcca aggcgattgg      1320
     ccagcccgtc agccgtcgac gcccgcgtgg tttctcgatt ccgcaagggg cgtccaccaa      1380
     tttctcggca ggcgccgctt cgtctacccg tgggtcgcgt ggttggtgca acgcggcgcc      1440
     gcaccgggtg atgttctggt gttcaccgac gacgacaccg acaagaccat tgacctgctc      1500
     atcgcgtgtc accttgcggg ttgcgggtac agcgtctgcg acaccgctga cgaaatttcc      1560
     gtgcggacca atgcgattac cgagcacggc gatggcatct tggtgacagt ggtcgacgtg      1620
     gccgccaccc agctggcggt tgtcggccat gacgagctgc ggaaggtcgt tgacgagcgc      1680
     gtcacacagg tgacacacga cgcactgctg gccaccaaga ccgcctacat catgccgacc      1740
     tcgggaacta ccggacaacc caagctggtg cgaatctcac acggctcgct cgcggttttc      1800
     tgtgatgcga tcagccgcgc ctacggttgg ggagcccacg acaccgttct gcagtgcgct      1860
     ccgttgacat cggacatcag cgtcgaggag attttcggtg gcgcggcctg tggcgcgcga      1920
     ctggtgcgat ccgcggctat gaaaaccggc gacctggcgg cgctggttga cgatctcgtc      1980
     gcccgcgaga cgacaatcgt cgacctgccg accgccgtct ggcagctgtt gtgcgccgac      2040
     ggcgacgcca ttgacgcgat cggccgctcg cgcctgcggc agatcgtaat cggcggtgaa      2100
     gccatccgct gtagcgccgt ggacaagtgg cttgaatcgg ctgcttcaca agggatctcg      2160
     ctgctctcga gctatggtcc aacagaagcc acggtcgtcg ccaccttctt gccgatcgtt      2220
     tgcgaccaga ccaccatgga cggcgcactg ctcaggctcg gccggccgat cctaccgaac      2280
     acggtgttcc tcgcgttcgg tgaagtcgtc attgtcgggg atttagtcgc cgacggctac      2340
     ctcgggatcg acggcgacgg cttcggcacc gtgacggccg cagacggttc ccgacgccgt      2400
     gcctttgcca ctggcgaccg ggtgaccgtc gacgccgaag gatttccggt cttctccgga      2460
     cgcaaagacg ccgtcgtcaa gatctccggc aagcgtgtcg atatcgctga ggtaaccagg      2520
     cgcatcgccg aagaccccgc ggtgtcagat gtcgccgtcg agttgcacag cggaagcctc      2580
     ggagtgtggt tcaagagcca acggacccgc gagggcgaac aagacgctgc cgcggcgacc      2640
     cggatcaggc tcgtcctcgt gagtctggga gtgtcgtcgt ttttcgttgt cggcgtgccg      2700
     aatatcccga ggaagcccaa cgggaagatc gacagcgaca acctgccgag gctgcctcag      2760
     tggtcagctg ctgggctaaa caccgccgag acgggtcagc gagcggccgg cctctcgcag      2820
     atctggagcc ggcagctcgg ccgggcaatc gggccggact cgtcgctgct tggtgagggc      2880
     atcggctcgt tggatctcat cagaatactg cccgagacgc gtaggtatct ggggtggcgc      2940
     ctctcgctgc tggatctgat cggtgccgat accgccgcca atctggccga ttacgcgcca      3000
     acgcccgacg cgccgacggg cgaagatcgg tttaggccgc tggtggccgc gcaacggccc      3060
     gcggcgattc cgttgtcgtt tgcccagcgg cgactatggt ttctcgacca gttacagcga      3120
     cccgctccgg tctacaacat ggcggtggcg ttgcggctgc gcgggtatct cgataccgag      3180
     gcgttgggcg cggcggtcgc cgatgtcgtg ggccgccacg aaagcctacg gacggtgttt      3240
     ccggcggtcg acggggtccc tcggcagctg gtcatcgaag cgcggcgggc agatcttggc      3300
     tgcgacatcg tcgatgccac cgcatggccg gctgaccggc tgcaacgggc catcgaggag      3360
     gcggcgcgcc acagcttcga tttggcaacc gagatacctt tgcggacgtg gcttttccgg      3420
     atcgccgacg acgaacatgt gctggtggcg gttgcacacc atatcgccgc cgacggctgg      3480
     tcggtggctc cgctgacggc cgatctgagt gcggcatatg ccagccgttg tgcgggtcgg      3540
     gcaccggact gggcgccatt gccagtgcag tatgtcgatt acacgctgtg gcagcgggaa      3600
     atcctcggtg atctcgacga cagcgacagc ccgatcgccg cgcagctggc ctactgggaa      3660
     aatgcgttgg ccggtatgcc ggaacggctg cggctgccca ccgctcggcc ctatccaccg      3720
     gttgccgatc agcgcggcgc cagtttggtg gtggattggc cggcgtcggt gcaacagcag      3780
     gtgcgtcgga tcgcccgcca gcacaacgcg accagcttca tggtggtagc tgccgggttt      3840
     gccgtgctgc tgtcgaaact cagcggaagc cccgatgtgg cggtcggatt tcccatcgcc      3900
     ggccgcagcg atcctgcgct ggataacttg gtgggctttt ttgtcaacac cttggtgttg      3960
     cgggtcaacc tggccggtga tcccagcttc gccgaactgc tggggcaggt gcgagcgcgc      4020
     agcctggccg cctacgaaaa tcaagacgta cctttcgagg tgctcgttga tcgcctcaaa      4080
     cccactcgag ccctgaccca tcacccgctg atccaggtga tgttggcctg gcaggacaat      4140
     ccggttggac agctgaattt gggtgatctg caggccaccc cgatgccgat cgacacccgc      4200
     accgcccgca tggacttggt gttttcgtta gcggaacgct tcagcgaggg tagcgaacct      4260
     gccgggatcg gcggagcggt ggaataccgc accgatgtgt ttgaagccca agcaatcgac      4320
     gtgcttatcg agcggttgcg gaaggtgttg gtggcggtgg ccgctgctcc ggaacggacg      4380
     gtgtcgtcga tcgatgcgct ggatgggacc gagcgtgccc ggttggatga gtggggtaac      4440
     cgcgctgtgc tgactgcgcc cgcgcccacg ccggtgtcga tcccgcagat gttggccgcc      4500
     caggtggcac gtatccccga agcggaggcg gtgtgttgcg gggacgcgtc gatgacgtat      4560
     cgggaactcg acgaggcgtc caaccggtta gcgcatcggc tggcaggttg tggggccggc      4620
     ccgggcgagt gtgtggcgct gctgttcgag cggtgcgcgc cggcggtcgt ggcgatggtg      4680
     gcagtgctca aaaccggggc ggcgtatctg ccgatcgatc cggcgaatcc tccgccgcgg      4740
     gtggcgttca tgctcggcga cgcggtgccc gtggccgcgg tcaccacggc tgggctgcgc      4800
     tcccggttgg cgggacacga cttgccgatc atcgatgtcg tcgatgcttt agcggcatat      4860
     ccgggcacgc ccccacccat gccggccgca gtgaacctcg cctacatcct gtacacctcg      4920
     ggcactaccg gcgagcccaa aggcgtgggg atcacccatc gcaacgtcac caggctgttc      4980
     gcatcactgc cggcacgctt gtcggcggcg caggtgtggt cgcagtgtca ttcctatggc      5040
     ttcgacgcct cggcgtggga gatctggggc gcgttgctag gtggtgggcg actggtgatc      5100
     gtgcccgagt cggtggcggc ctcgccgaac gactttcatg ggctgctcgt ggccgaacac      5160
     gtcagcgtgc tgactcagac tccggctgcg gtggcaatgt tgccgacgca gggtttggag      5220
     tcggtggcgt tggtggtggc cggtgaggca tgtccggcag cgctggtgga tcggtgggcg      5280
     cccgggcggg tgatgctaaa tgcttatggc ccaaccgaga ccacgatctg tgcggcgata      5340
     agtgcgccgt tgcgaccggg ttcggggatg ccgccgattg gtgttccggt gtcgggggcg      5400
     gcgttgtttg tgctggatag ctggttgcgc ccggtaccgg ccggggtggc cggagagttg      5460
     tacattgccg gtgcgggcgt cggtgttggg tattggcgtc gggcggggct gaccgcgtca      5520
     cggtttgtgg cctgcccatt cggcggttcc ggggcacgca tgtatcgcac cggggatctg      5580
     gtgtgttggc gcgccgatgg ccagttggag ttcctggggc gcaccgacga tcaggtcaag      5640
     atccgcgggt atcgcatcga gctcggcgag gttgcgaccg cgctggccga gctggctggg      5700
     gtaggtcaag cggttgtaat cgcccgtgaa gaccgccctg gggacaagcg cctagtcggg      5760
     tatgccaccg aaattgcccc cggggcagtg gacccggccg ggctgcgggc gcaactagcc      5820
     cagcgattgc ccggttacct ggtgccagcc gcggtggtag tgatcgatgc gcttccgttg      5880
     acggtcaacg gcaaacttga tcatcgtgcg ttgccggcac cggaatacgg tgataccaac      5940
     ggatatcgcg ctccggccgg gccggttgag aagaccgtgg ccggcatctt tgcccgggtg      6000
     cttgggcttg agcgggtcgg cgtcgacgac tcgttcttcg agctcggcgg cgattcgctg      6060
     gcggcaatgc gggttatcgc cgcgatcaac accaccctaa acgccgatct gccggtgcgc      6120
     gcgttgctgc acgcgtcgtc gacgagaggt ttaagccagc tgttggggcg agatgcccga      6180
     ccgaccagcg atccgcgctt ggtgtctgtg cacggcgaca accccaccga ggtgcatgcc      6240
     agcgacctca cgctggaccg gttcatcgac gccgacacgc tggccaccgc cgtcaacctg      6300
     ccgggcccga gccccgagct acggacggtc ctgctgacgg gcgcgacggg tttcctcgga      6360
     cggtatctgg tccttgaatt gctgcggcgg ctggacgtcg acggcaggct gatctgtttg      6420
     gtgcgggcgg agtccgacga ggatgcgcgg cgtcgtctgg agaagacctt cgatagcggt      6480
     gacccggaat tgctgcggca cttcaaggag cttgccgccg accggctgga ggtcgtcgca      6540
     ggcgacaaga gcgaacccga cctgggcctg gaccaaccga tgtggcggcg gctggccgaa      6600
     accgtggatt tgattgtcga ttccgcggcg atggtcaacg cgtttcccta ccacgaattg      6660
     ttcgggccca acgtcgcggg caccgccgag ctgatccgaa tcgcgcttac caccaagctc      6720
     aaacccttca cctacgtgtc aaccgccgac gtgggtgctg cgatcgagcc gtcggcgttc      6780
     accgaggacg ccgacatccg ggtaatcagc cccacccgca ccgtcgacgg cggctgggct      6840
     ggcggctacg gcaccagcaa gtgggccggt gaggtgctgc tgcgcgaggc caacgacctg      6900
     tgcgcgctgc cggtcgcggt gtttcgctgc gggatgatcc tggccgacac cagctatgcc      6960
     ggacagctca acatgtcgga ctgggtcacc cggatggtgt tgagcttgat ggctaccggc      7020
     atcgcgcctc gttcgttcta cgaaccggac tccgagggca atcggcaacg cgcgcacttc      7080
     gacgggctgc cagtcacctt cgttgccgag gcgatcgcgg tgctgggcgc gcgggtggcc      7140
     ggctcatcgt tggcgggatt tgcgacctat cacgtgatga acccgcacga cgacggtatc      7200
     gggctcgatg agtatgtgga ctggctgatt gaggccggct acccgatacg ccgcatcgat      7260
     gactttgcgg agtggttgca gcggtttgag gccagcctgg gcgctctgcc ggatcggcaa      7320
     cgccggcact cggtgctgcc gatgctgctg gcgagcaatt cccagcgatt gcagccgctt      7380
     aagccgacca gggggtgctc cgcgccgacc gaccgattcc gtgccgcggt gcgagcggcg      7440
     aaagtcggct ccgacaagga caatccagac atcccgcacg tgtcggcgcc gaccatcatc      7500
     aactacgtca ccaacctaca actgctcgga ctgctgtag                             7539
//

If you have problems or comments...

PBIL Back to PBIL home page