(data stored in ACNUC1104 zone)

EMBL: CP000717.PE103

CP000717.PE103       Location/Qualifiers
FT   CDS_pept        117848..119833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10103"
FT                   /old_locus_tag="TBFG_00102"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0102"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10103"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04446"
FT                   /protein_id="ABR04446.1"
FT                   /translation="MGTHGATKSATSAVPTPRSNSMAMVRLAIGLLGVCAVVAAFGLVS
FT                   GARRYAEAGNPYPGAFVSVAEPVGFFAASLAGALCLGALIHVVMTAKPEPDGLIDAAAF
FT                   RIHLLAERVSGLWLGLAATMVVIQAAHDTGVGPARLLASGALSDSVAASEMARGWIVAA
FT                   ICALVVATALRLYTRWLGHVVLLVPTVLAVVATAVTGNPGQGPDHDYATSAAIVFAVAF
FT                   ATLTGLKIAAALAGTTPSRAVLVTQVTCGALALAYGAMLLYLFIPGWAVDSDFARLGLL
FT                   AGVILTSVWLFDCWRLLVRPPHAGRRRGGGSGAALAMMAAMASIAAMAVMTAPRFLTHA
FT                   FTAWDVFLGYELPQPPTIARVLTVWRFDSLIGAAGVVLAIGYAAGFAALRRRGNSWPVG
FT                   RLIAWLTGCAALVFTSGSGVRAYGSAMFSVHMAEHMTLNMFIPVLLVLGGPVTLALRVL
FT                   PVTGDGRPPGAREWLTWLLHSRVTTFLSHPITAFVLFVASPYIVYFTPLFDTFVRYHWG
FT                   HEFMAIHFLVVGYLFYWAIIGIDPGPRRLPYPGRIGLLFAVMPFHAFFGIALMTMSSTV
FT                   GATFYRSVNLPWLSSIIADQHLGGGIAWSLTELPVIMVIVALVTQWARQDRRVASREDR
FT                   HADSDYADDELEAYNAMLRELSRMRR"
     atggggacgc acggggctac caagagtgcg acgtcggctg tgccaacgcc ccggtcgaac        60
     tccatggcga tggtacggct ggcaattggc ctgctgggtg tgtgcgcggt ggtcgcggcc       120
     ttcgggctgg tgtcgggagc gcgccgctac gctgaggccg gcaatcccta tccgggcgcc       180
     ttcgtcagcg tcgccgagcc ggtcgggttc ttcgccgcgt cgctggccgg tgcgctgtgt       240
     ctgggcgcgc tgatccacgt ggtcatgacg gccaaacccg agccggatgg cttaatcgac       300
     gccgcggcgt tccggattca cctgctggca gaacgtgttt caggtctctg gttggggcta       360
     gccgcgacca tggtggtcat tcaggccgcc cacgatactg gagtggggcc cgcgagactg       420
     ctggctagtg gggcactatc ggactccgtc gccgcctccg agatggcacg cgggtggatt       480
     gttgcggcga tctgcgcgct ggtggttgcg acggcgctgc ggctgtacac tcgctggctc       540
     gggcacgttg tgctgcttgt ccccactgtg cttgccgtcg tcgccaccgc ggtgaccggt       600
     aacccgggac agggacccga ccatgactac gcgaccagcg ccgcgatcgt gttcgcggtc       660
     gcgttcgcca ccttgaccgg gctcaagatc gctgcggcgt tggcgggaac gacgccaagc       720
     cgcgctgtgc tggtaacgca ggtcacctgt ggagcgctcg cgttggcata cggagcgatg       780
     ctgctttatc tcttcatccc gggctgggcg gtcgattcgg attttgcccg ccttggtctg       840
     cttgcggggg taatcctgac gtcggtgtgg ttgtttgact gctggcggct gttggtcagg       900
     ccgccacatg cgggccgtcg ccgcggtggt ggctccggtg ccgcactggc catgatggcc       960
     gccatggctt cgatagctgc catggccgtt atgaccgcgc cgcgatttct cacccacgcg      1020
     ttcacggctt gggatgtctt cctcggctat gaactgccgc aaccgccgac catagcccgg      1080
     gtgctcaccg tgtggcgctt cgatagcctg atcggagccg ctggtgtggt tctcgcgatc      1140
     gggtatgcgg cgggcttcgc cgcgctgcgg cgccgaggta actcttggcc ggtgggcaga      1200
     ttgatcgcct ggctgactgg ttgcgccgca ctggtattca ccagcggctc cggtgtacgg      1260
     gcctatggtt cggcgatgtt cagcgtccac atggccgaac acatgacact gaacatgttc      1320
     atcccggtcc tgttggtgct cggtggcccg gtcacgctgg cgctgcgggt gctgccggta      1380
     acgggtgatg gacggccgcc gggggctcgc gaatggctga cctggctgct gcactcccgg      1440
     gtgacaactt tcctgtcgca cccgatcacc gcattcgtcc tctttgtggc ctcgccctat      1500
     atcgtctatt tcacaccgct gttcgatacc ttcgtccgct atcactgggg ccacgagttc      1560
     atggcgatcc atttcctggt ggtcgggtac ttgttctact gggcgatcat cggcatcgac      1620
     ccagggccgc gccgactgcc ctacccgggc cggatcgggc tgttgttcgc ggtgatgccg      1680
     ttccacgcct tcttcgggat cgcgctgatg acgatgtcgt ctacggtggg cgctacgttc      1740
     tatcgttccg tcaatctgcc gtggttgtcg agcatcatcg ccgaccagca tctcggcggt      1800
     ggaattgctt ggagcctaac ggaattgccg gtcatcatgg tcatcgtggc gctggttacc      1860
     caatgggcgc gccaagaccg ccgagtcgcg tcccgcgaag accggcatgc cgacagcgac      1920
     tacgccgacg acgagctgga agcctacaac gcgatgcttc gcgagttgtc gcgaatgcgg      1980
     cgctga                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page