(data stored in ACNUC1104 zone)

EMBL: CP000717.PE124

CP000717.PE124       Location/Qualifiers
FT   CDS_pept        148992..149360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10124"
FT                   /old_locus_tag="TBFG_00122"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0123"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10124"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04467"
FT                   /protein_id="ABR04467.1"
FT                   /translation="MTKKPRNPADYVIGDDVEVSDVDLKQEEVYVDGERLTDERVEQMA
FT                   SESLRLAREREANLIPGGKSLSGGSAHSPAVQVVVSKATHAKLKELARSRKMSVSKLLR
FT                   PVLDEFVQRETGRILPRR"
     atgacgaaga agccacgtaa ccccgccgac tacgtgatcg gcgacgatgt cgaggtgtct        60
     gacgtcgatc tcaagcaaga ggaggtctat gtcgatggcg agcggctaac ggacgagcgc       120
     gtcgagcaga tggcttcaga gtcgctgcgg ctggcgcgcg aacgagaagc caacctgatt       180
     cctggcggca agtctctgtc cggcggctct gcgcactcgc cggctgtgca ggtggtcgtt       240
     tcgaaggcta cccacgccaa gctcaaggag ctggcgcgca gccggaagat gagcgtatct       300
     aagctgctgc gtcccgtgct cgacgagttc gtacagcgag aaacgggtcg gattctccca       360
     cggcgttag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page