(data stored in ACNUC1104 zone)

EMBL: CP000717.PE138

CP000717.PE138       Location/Qualifiers
FT   CDS_pept        complement(165028..165576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10138"
FT                   /old_locus_tag="TBFG_00136"
FT                   /product="peptide methionine sulfoxide reductase msrA"
FT                   /note="Mapped to H37Rv Rv0137c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10138"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04481"
FT                   /protein_id="ABR04481.1"
FT                   /translation="MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYR
FT                   NHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTTKDRQGNDRGTSYRSAIFYFDEQQK
FT                   RIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPGWRL
FT                   PRRTAESALRASLSPELGT"
     atgacgagca atcagaaagc gatcctcgcc ggcggctgct tttgggggct gcaggatctg        60
     atccgcaacc agcccggtgt ggtctccacg cgggtgggct acagcggcgg gaacatcccc       120
     aacgcaacct accgtaacca cggcacgcac gccgaagccg tcgaaatcat cttcgacccc       180
     acggtcaccg attaccgcac cctgctggaa ttcttcttcc agatccacga cccgacaacc       240
     aaagaccggc aaggtaacga ccgggggacc agctaccggt cggccatctt ctacttcgat       300
     gagcagcaaa agcggatcgc gctggacacc atcgccgatg tcgaggcatc cggcctgtgg       360
     cccggcaagg tggtgaccga ggtcagcccg gccggggatt tctgggaagc cgaacccgag       420
     caccaggact acctgcagcg ctaccccaac gggtacacgt gccacttcgt ccggcccggc       480
     tggaggctac cccgacggac cgccgaatct gcactgcggg ccagcctttc acccgaactc       540
     gggacctga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page