(data stored in ACNUC1104 zone)

EMBL: CP000717.PE141

CP000717.PE141       Location/Qualifiers
FT   CDS_pept        167226..167606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10141"
FT                   /old_locus_tag="TBFG_00139"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0140"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04484"
FT                   /protein_id="ABR04484.1"
FT                   /translation="MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEA
FT                   SYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPA
FT                   VAAIAGHVACYPDKAEISIFPG"
     atgagcaacc ggattgtgtt agaacccagc gccgatcacc cgatcaccat cgagccgacc        60
     aaccgacggg tgcaggtacg cgtcaatggc gaggtggtcg cggacacggc cgcggcgctg       120
     tgcttgcagg aagccagtta ccctgcagtg caatatattc cgttggccga cgtggtacag       180
     gataggctga tccgcaccga gaccagcacc tattgcccgt tcaagggtga agccagctat       240
     tacagcgtga ctaccgacgc cggcgacatc gtcgacgacg tgatgtggac gtacgaaaac       300
     ccttatccgg cggtagcggc gatcgcgggg catgtcgcgt gctatccgga caaagccgaa       360
     atcagcatct tcccggggta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page