(data stored in ACNUC1104 zone)

EMBL: CP000717.PE143

CP000717.PE143       Location/Qualifiers
FT   CDS_pept        168027..168953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10143"
FT                   /old_locus_tag="TBFG_00141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0142"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10143"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04486"
FT                   /protein_id="ABR04486.1"
FT                   /translation="MRSIDVVVEAVVTFAGAAGFAHTLAPLRRGQQDPCFRVPGDGTIW
FT                   RTSLLPTGPVTARISRAGRDAARCVAWGSGAEEFVDMAPAMLGAADDASDFVPLHPAVA
FT                   AAHRRLPNLRLGRTGQVLEALIPAVIEQRVPGADAFRSWRLLVSKYGTQAPGPAPPGMR
FT                   VPPSAEVWRHIPSWEFHRANVDPGRARAVVGCAQRAASLERLVSLPAARAAEALTSLPG
FT                   VGVWTAAETTQRVFGDADAVSVGDYHIPKMIGWTLVGRPVDDAGMLELLEPMRPHRHRV
FT                   VRLLEASGLAREPRRGPRLPVQNIRAL"
     gtgcggtcaa ttgacgtggt cgtcgaagcg gtggtcacct tcgcgggggc ggccggcttc        60
     gcgcacacct tggcgccgtt gcgtcgcggt cagcaggatc catgctttcg ggtccccggt       120
     gacggcacta tctggcggac cagcttgctg cccaccgggc cggtcaccgc gcggatcagc       180
     cgtgctgggc gcgacgccgc ccgttgcgtg gcgtggggca gcggtgccga ggagtttgtc       240
     gacatggcgc ccgccatgct gggcgccgcc gacgacgcca gcgatttcgt gccgctgcat       300
     ccggccgtgg ccgccgcgca ccgccggctg ccgaacttgc gcctgggccg caccggccag       360
     gtgctggaag ccttgatccc ggcggtcatc gagcagcggg tacccggcgc cgacgcgttt       420
     cggtcgtggc ggctgttggt gtccaagtac ggaacgcagg cccccggtcc ggcgccaccc       480
     ggcatgcggg tgccgccgtc ggccgaggtg tggcgtcaca tcccgtcctg ggagtttcat       540
     cgcgccaatg tcgacccggg gcgggctcgc gcggtggtgg gttgcgcgca gcgggcggcg       600
     tcgctggagc ggctggtgtc gctgcccgcg gctcgggcgg cggaggcgct gacatcgttg       660
     cctggagtcg gggtatggac cgcggccgag accacacaac gcgtgttcgg tgacgccgac       720
     gccgtgtcgg tcggcgacta ccacattccg aagatgatcg gctggacgct tgtgggccgg       780
     ccggtcgacg acgccggcat gctcgagctg ctggagccga tgcgcccgca tcgccaccgg       840
     gtggtccgct tgctcgaagc cagcggcttg gcgcgtgagc cgcgccgcgg gccccggctg       900
     ccggtacaga acatccgggc gctgtag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page