(data stored in ACNUC1104 zone)

EMBL: CP000717.PE152

CP000717.PE152       Location/Qualifiers
FT   CDS_pept        complement(177859..179625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10152"
FT                   /old_locus_tag="TBFG_00150"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0151c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10152"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04495"
FT                   /protein_id="ABR04495.1"
FT                   /translation="MAPFGFTPKARHNRGVALRSTYRLDGWVMGPVDKEGWGLSYVFAQ
FT                   PSVLAAAATDLAGIGSAINQATAAVAAPTTGLAAAAADEVSTALATLFGAYGQQFQAIS
FT                   AQVAAFHNEFTQRLAAAANAFVNAEATNTSALVQEATAGLFKPTSPPVLPPMFNQNTAI
FT                   IMGGTGSPIPTPSYVNAITTLFIDPVVSNPVVKALVTPEELYPITGVKSLPFQTSVQLG
FT                   LQILDGAIWEQINAGNHVTVFGYSQSAVIASLEMQHLISLGPNAPSPSQLNFILIGNEM
FT                   NPNGGILARIPGLNVTTLGLPFYGATPDNPYPTTTYTLEYDGFADFPRYPLNVLSDINA
FT                   VFGILTVHTTYADLTPAQIASATQLPTQGTTSNTYYIIETEHLPLLAPLRAIPVIGPPL
FT                   AALVEPNLEVIVNLGYGDPRFGYSTSPANVPTPFGLFPDVPASVVADALVAGTQQGVND
FT                   FMVELPAALNTLPQTPMPAFPPYVPTLLPPPPPPQPATLINIADTFASVVSTGYSILLP
FT                   TADLGLAFVTILPAYDLTLFVNQLAAGNLRAAIELPLAATIGLAALGGMIEFIAIVVTL
FT                   ADITQQLQSFSI"
     atggccccat ttgggttcac tccaaaggcc agacacaacc gcggagtcgc tttacgctca        60
     acgtatcggc tcgacgggtg ggttatgggc cccgtcgaca aggagggatg gggtttgtcg       120
     tacgtattcg cgcagccgtc ggtattggca gcggcggcta ccgatttggc cgggatcggc       180
     tcggcgatca accaggctac ggcggccgtc gcggccccga caaccggcct ggcggcggct       240
     gccgcggacg aagtgtccac ggcccttgcc acgctgttcg gcgcgtacgg ccagcagttc       300
     caggcgatca gcgcacaggt tgcggcgttt cacaacgaat tcacccagag gttggcggcg       360
     gccgcaaacg catttgtcaa tgccgaggcc accaacacga gcgcgctggt gcaggaggcg       420
     acggccggac tctttaagcc aacctcaccc ccggtgctac cgccaatgtt caaccaaaat       480
     acggcgatca tcatgggcgg caccgggtca ccgataccca cgccgagtta tgtcaacgcc       540
     atcacgacct tgttcatcga ccccgtcgtc tcgaatccgg tcgtcaaagc gctggtgacg       600
     cccgaagagc tatatccgat caccggcgtc aaatccctgc ccttccaaac ctcggtgcag       660
     ttgggcctac agattctcga cggcgcgatt tgggagcaaa tcaacgccgg aaaccacgtc       720
     accgtgttcg gctattcgca gagcgccgtc atcgcgtccc tggaaatgca gcacctcatc       780
     tcgctgggtc ccaacgctcc cagccccagc cagctcaatt tcatcttgat cggcaacgag       840
     atgaatccca atggcgggat acttgcgcgc atacccggtc tgaatgtcac caccctcggc       900
     ctaccgttct acggggcgac cccggacaat ccctatccga cgacgaccta caccctcgag       960
     tacgacggtt tcgccgactt cccgcggtat ccactcaatg tcctgtccga tatcaacgca      1020
     gtattcggga tactcacggt gcacaccacg tatgcggacc tcacaccggc acagatagcg      1080
     tcggccacgc agttgccgac acagggcacg acgtcgaaca cgtactacat cattgaaacc      1140
     gagcatctgc cgctgctggc cccgttgcgg gcaatcccgg tcattggccc accgctggcg      1200
     gcgctggtcg aaccgaactt ggaagtaatc gtcaatctgg gttacggcga cccgaggttc      1260
     ggctattcga cgagcccggc gaacgtgcct accccattcg ggctcttccc ggatgtcccg      1320
     gcgagcgttg tcgccgatgc cctggttgcc ggaacgcaac agggcgtcaa cgacttcatg      1380
     gtcgagttgc cagccgccct gaacaccctg ccccaaactc cgatgcccgc gttcccgccg      1440
     tatgtgccga cgttgctacc gccgccaccg ccgccacaac cggcgacgct catcaacatc      1500
     gcggacactt tcgcttccgt tgtgtcgacc ggctactcga ttcttcttcc gacggcagat      1560
     ctaggtcttg ccttcgtcac tatcctgccc gcctatgacc tcaccctgtt cgtgaatcaa      1620
     ctggcggccg gcaacctccg cgctgcgatc gagctgccgc tcgcggccac cattgggttg      1680
     gccgccctgg gcggcatgat tgaattcatc gcgattgtgg tgacgttggc cgacattact      1740
     cagcaactgc aaagcttcag catctga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page