(data stored in ACNUC1104 zone)

EMBL: CP000717.PE157

CP000717.PE157       Location/Qualifiers
FT   CDS_pept        185039..185371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10157"
FT                   /old_locus_tag="TBFG_00155"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAb"
FT                   /note="Mapped to H37Rv Rv0156"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10157"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04500"
FT                   /protein_id="ABR04500.1"
FT                   /translation="MYNELLENLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIV
FT                   VLGALVVFGEIEHPSLVLQVILFVAVVFGTLNVIGGFIVTDRMLGMFKAKKPAVPAKPD
FT                   RDEALR"
     atgtacaacg aattgttgga gaacctggcg atcctggtgc tgtccggatt cgtcgggttc        60
     gcggtgatct cgaaagtgcc caacacgttg cacaccccgc tgatgtcagg aaccaacgcc       120
     atccacggca ttgtcgttct cggcgcgctg gtggttttcg gcgaaattga gcacccatcg       180
     ctcgtgttgc aggtcatcct gttcgtcgcg gtggtgttcg gcacgctgaa cgtcatcggc       240
     ggattcatcg tcaccgaccg aatgctcggc atgttcaagg ccaagaagcc cgccgtgcca       300
     gccaagcccg accgcgacga ggcgctccga tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page