(data stored in ACNUC1104 zone)

EMBL: CP000717.PE159

CP000717.PE159       Location/Qualifiers
FT   CDS_pept        187101..187745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10159"
FT                   /old_locus_tag="TBFG_00157"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0158"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10159"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04502"
FT                   /protein_id="ABR04502.1"
FT                   /translation="MPSDTSPNGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNK
FT                   ATVYHYYASKSLILFDIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTAIASNPERA
FT                   AVYFQEQPYITEWFTSEQVAEVREKEQQVYEHVHGLIDRGIASGEFYECDSHVVALGYI
FT                   GMTLGSYRWLRPSGRRTAKEIAAEFSTALLRGLIRDESIRNQSPLGTRKET"
     atgccatccg acaccagccc caacgggcta agccgccgtg aggagttgct ggctgttgcc        60
     accaaactat tcgcggcgcg cggttatcac ggcacccgga tggacgacgt cgccgatgtg       120
     atcgggctca acaaagcaac ggtctatcac tactacgcca gcaagtcgct gatcctgttc       180
     gacatttacc gtcaggcggc cgagggcacc ctggccgccg tgcacgacga tccgtcctgg       240
     acggcccgtg aagcgctgta ccagtacacg gtccggctgc tcactgcgat cgcgagcaac       300
     cccgagcggg ccgccgtgta cttccaggag cagccctaca tcaccgagtg gttcaccagc       360
     gagcaggtcg ccgaggtccg cgagaaggag cagcaagtct acgagcacgt acacggcctg       420
     atcgaccgcg ggattgccag cggcgagttc tatgagtgcg actcgcatgt ggtggcgctg       480
     gggtacatcg ggatgacgct gggcagctac cgctggctgc ggccgagcgg gcgccgaacg       540
     gccaaggaga tcgcggcgga gttcagcacg gcactgctgc gcgggctgat ccgcgacgaa       600
     tcgatccgca accagtctcc gcttggaact cggaaggaaa cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page