(data stored in ACNUC1104 zone)

EMBL: CP000717.PE16

CP000717.PE16        Location/Qualifiers
FT   CDS_pept        complement(18860..20335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10016"
FT                   /old_locus_tag="TBFG_00016"
FT                   /product="penicillin-binding protein pbpA"
FT                   /note="Mapped to H37Rv Rv0016c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10016"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04359"
FT                   /protein_id="ABR04359.1"
FT                   /translation="MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAE
FT                   DPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVV
FT                   ALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGS
FT                   TFKVITTAAALAAGATETEQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKS
FT                   CNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQK
FT                   DVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKL
FT                   TELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGADRLSATGGALAAPIGRAVIEAALQGEP"
     atgaacgcct ctctgcgccg aatatcggtg accgtgatgg cgttgatcgt gttgctactg        60
     ctcaacgcga ccatgacgca ggtcttcacc gccgacgggc tgcgtgccga tccccgcaac       120
     cagcgagtgt tgctcgacga gtattcacgg cagcgcggcc agatcaccgc tggtggccaa       180
     ctgctggcgt actcggtagc caccgacggc cgctttcgtt tcctgcgggt ctatcccaat       240
     cctgaggtgt acgcgccggt taccggcttc tactccctgc gctattccag caccgcccta       300
     gaacgagccg aggacccgat attgaacggg tccgaccgcc gtctgttcgg ccgccggctg       360
     gccgacttct tcaccggtcg cgacccacgc ggcggtaatg tcgataccac gatcaacccg       420
     cgcattcagc aagccggctg ggacgcgatg cagcaaggct gctacgggcc ctgtaaggga       480
     gcggtggtcg cccttgagcc atcaaccggc aagattttgg cgttggtgtc ttctccgtcc       540
     tacgacccca acctgctggc gtcgcataac cccgaggtgc aggcgcaagc ctggcagcgg       600
     cttggcgaca atcccgcctc tccactgacc aaccgtgcca tctctgagac gtatccaccg       660
     ggttcgactt tcaaagtgat caccactgcg gccgcgctgg ccgccggggc caccgagacc       720
     gaacagctga ctgcggcgcc cacaattccg ttgccaggca gcaccgccca gctagagaac       780
     tacggcggtg cgccgtgcgg ggacgaaccc accgtgtcgc tgcgtgaggc attcgtcaaa       840
     tcatgcaaca ccgcattcgt ccagctgggc atccgcaccg gcgccgacgc cctgcgcagc       900
     atggcgcgcg cgttcggtct cgatagccca ccgcgcccaa ctccgctgca agtggcggaa       960
     tcaaccgtcg ggcctatccc ggacagcgcc gcactaggga tgaccagtat cggccaaaag      1020
     gacgttgcgc tgaccccgct agcgaacgca gaaatagccg cgaccatcgc aaacggcggc      1080
     attacgatga ggccttatct agtcggcagc ctcaagggac cggacctagc caatatctca      1140
     accaccgtcg gataccagca gcgccgcgcg gtgtcaccgc aggtcgccgc taagctaaca      1200
     gagctgatgg tcggcgccga gaaagtcgca cagcagaaag gggcaatccc cggcgtgcag      1260
     atcgcatcca agacgggcac cgccgaacat ggcaccgacc ctcgtcacac tccaccgcac      1320
     gcttggtaca tcgcctttgc gcccgcacaa gcgcccaagg tggctgttgc cgtgctggtg      1380
     gagaacgggg ctgatcggct gtccgccacc ggaggtgccc tcgcggcacc gatcgggcgg      1440
     gcggtgatcg aagccgcact gcagggggaa ccatga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page