(data stored in ACNUC1104 zone)

EMBL: CP000717.PE160

CP000717.PE160       Location/Qualifiers
FT   CDS_pept        complement(187749..189155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10160"
FT                   /old_locus_tag="TBFG_00158"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0159c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04503"
FT                   /protein_id="ABR04503.1"
FT                   /translation="MSYVIAAPEMLATAAADVDGIGSAIRAASASAAGPTTGLLAAAAD
FT                   EVSSAAAALFSEYARECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGS
FT                   SGALGSVGMLSGNPLTALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQW
FT                   WPFIGNLSLDQSIAQGVTLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPG
FT                   QAPDPSRLAFTLIGNINNPNGGVLERYVGLYLPFLDMSFNGATPPDSPYQTYMYTGQYD
FT                   GYAHNPQYPLNILSDLNAFMGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLT
FT                   QDLPLLQPIRAIPFVGTPIAELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVAS
FT                   ALATGTVQGPQAALVSIGLLPQSALPNTYPYLPSANPGLMFNFGQSSVTELSVLSGALG
FT                   SVARLIPPIA"
     atgtcctacg tcatcgcggc cccggagatg ttggcaacgg cggccgcgga cgtggacggg        60
     atcggttcgg cgatacgagc ggccagcgcg tccgctgcgg gtccaacgac cggactgctg       120
     gccgcggccg ccgatgaggt gtcgtcggcc gctgcagcgc tgttcagcga atacgcgcgc       180
     gaatgtcaag aggtcctaaa gcaggctgcg gcgttccatg gcgagttcac ccgggcgctg       240
     gctgccgccg gggccgccta tgcccaggct gaagccagca acaccgctgc tatgtcgggc       300
     accgccgggt ccagcggcgc cctcggttct gtcgggatgc tgtcaggcaa cccgctaacc       360
     gcgttgatga tgggcggcac cggggaaccg atccttagtg accgcgtctt ggcgatcatt       420
     gacagcgcat acattcggcc cattttcggg cccaacaacc cggtcgccca gtacacgccc       480
     gagcagtggt ggccgtttat cgggaacctg tcactggacc aatccatcgc ccagggtgtc       540
     acgctgctga acaacggcat caacgcggaa ctacaaaatg ggcatgacgt cgtcgttttc       600
     ggctactcgc aaagcgccgc ggtagcgacc aatgaaatac gcgctcttat ggcgttacca       660
     ccgggccaag ccccagatcc aagccggctg gctttcacgt tgatcggtaa tatcaataac       720
     cccaacggcg gcgtcctcga gcgttacgtg ggcctttacc tcccgttctt ggatatgtcg       780
     ttcaacggtg cgactccacc ggattccccc taccagacct acatgtacac cggccaatac       840
     gacggctacg cccacaaccc gcagtacccg ctcaatatct tgtcggacct caacgccttc       900
     atgggcatca gatgggtgca caacgcgtac cccttcaccg cggccgaggt tgccaatgcc       960
     gtgccgttgc ccacgtctcc gggctacacc ggcaacaccc attactacat gtttctgacc      1020
     caggacctgc cgctgttgca gccgattcgc gccatcccct tcgtagggac cccaatagcc      1080
     gagctgattc agcccgacct acgggtgcta gtcgacttgg gctatggcta cggctacgcc      1140
     gacgtaccca ccccggccag cctgttcgcg ccaatcaacc cgatcgccgt ggcctcggcc      1200
     ctggcgaccg ggaccgtgca aggcccccaa gccgccctag taagcatcgg attgttaccg      1260
     cagtccgcgc tacccaatac gtatccgtat cttccgtcgg cgaatccggg cctgatgttc      1320
     aacttcggtc aatccagtgt gacggagttg tcggtgctca gtggcgccct cgggtccgta      1380
     gcgagattga ttccaccgat cgcgtga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page