(data stored in ACNUC1104 zone)

EMBL: CP000717.PE161

CP000717.PE161       Location/Qualifiers
FT   CDS_pept        complement(189247..190755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10161"
FT                   /old_locus_tag="TBFG_00159"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0160c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04504"
FT                   /protein_id="ABR04504.1"
FT                   /translation="MSHLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGD
FT                   EVSAATAALFSAYGREYQAVVKQAAAFHSEFTRTLEAAGNAYAHAEAANAARVSHALDT
FT                   INAPIRTLLGRAPLSPNGSSGAGGLPAIAQLAAESPITALIMGGTNNPLPDPEYVTDIN
FT                   KAFIQTLFPGAVSQGLFTPEQFWPVTPDLGNLTFNQSVTEGVALLNTAVNNQLALDNKV
FT                   VAFGYSQSATIINNYINSLMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDV
FT                   PFNGATPANSPYPTHIYTAQYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQV
FT                   DNAVPLPTSPGYTGNTQYYMFLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYA
FT                   DYGPGGNYADIPTPAGLFSIPNPFAVTYYLIKGSLQAPYGAIVEIGVEAGLIGPEWFPD
FT                   SYPWVPSINPGLNFYFGQPQVTLLSLMSGGLGNILHLIPPPVFT"
     atgtcgcacc tggtcacagc ccctgacatg ctggcgacgg cagctgccca tgtggatgag        60
     atcgcttcca cgctgcgggc cgccaacgcg gctgcggcag gcccgacatg taacctgctg       120
     gccgcggccg gcgatgaggt ttcggcggca acggcggccc tgttcagcgc atacgggcgg       180
     gagtatcagg cggtcgtcaa gcaggccgcg gcgttccaca gcgagttcac ccggacgttg       240
     gaggccgccg gcaacgccta cgcacacgcc gaagcggcca atgcggcccg ggtatcgcac       300
     gcgctggaca ctatcaacgc accgatccgg acgctgttgg gccgtgcgcc gttgagcccc       360
     aacggatcca gcggggccgg cgggctgccg gcgatcgcgc agctggctgc ggagagtccg       420
     ataacggcgt tgattatggg cggcaccaat aacccgctac ccgaccccga gtacgtgaca       480
     gacatcaaca aggctttcat ccagaccctc ttcccgggtg ctgtctcgca aggcctgttc       540
     acgcccgagc agttctggcc ggttaccccc gacctcggca atctgacgtt caaccagtcc       600
     gtcaccgaag gcgtggcgct gctgaatacc gccgtcaaca accaactggc cctcgacaac       660
     aaggtcgttg cgttcggcta ctcgcagagc gccacgatca tcaacaacta catcaattcg       720
     ctgatggcga tgggttcgcc gaatccggac gatatctcct tcgtcatgat tggtagtggc       780
     aacaatcccg tcggcgggct gctggcgcgc ttccccggct tctacatccc gttcctggac       840
     gtgccgttca atggcgcaac cccggcgaat agtccctacc cgacacacat ttacacggcc       900
     cagtacgacg gcatcgccca cgcgccgcaa ttcccgctgc gcatcctgtc ggacatcaac       960
     gccttcatgg gctacttcta cgtgcacaac acgtacccgg aactcatggc cacccaggtg      1020
     gataacgcgg tgccgttgcc gacctccccg ggctataccg gcaacaccca gtactacatg      1080
     ttcctgactc aggatctgcc actgctccag ccgatccgtg acatccccta cgccggtccc      1140
     ccgatcgccg acctgttcca gccgcagctg cgggtgctcg tcgacttggg ctacgccgac      1200
     tacgggccgg gcggcaatta cgcggatatc cccactccgg ccgggctgtt ctcgatcccc      1260
     aacccgttcg ctgtcacgta ttacctgatc aaagggagcc tgcaggcgcc ctatggcgcc      1320
     atcgtggaga ttggggtgga agccggattg attgggccgg agtggttccc ggacagctat      1380
     ccgtgggtcc cgtcgataaa cccgggcctg aatttctact tcggccagcc acaggtgaca      1440
     ctgctatccc tgatgagtgg cggtctcggc aacatcctgc acctgatccc gccaccggtc      1500
     ttcacctga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page