(data stored in ACNUC1104 zone)

EMBL: CP000717.PE163

CP000717.PE163       Location/Qualifiers
FT   CDS_pept        complement(192300..193451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10163"
FT                   /old_locus_tag="TBFG_00161"
FT                   /product="zinc-type alcohol dehydrogenase subunit E adhE"
FT                   /note="Mapped to H37Rv Rv0162c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04507"
FT                   /protein_id="ABR04507.1"
FT                   /translation="MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPP
FT                   DRGEVLVRIEAAGVCHSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVV
FT                   LVFLPRCGQCAACATDGRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATH
FT                   VVVNRASVVPVPHEVPPTVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAV
FT                   LTALTYTDVRVVAVDQLPEKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALH
FT                   TAIGLTAPGGRTITVGLPPPDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLW
FT                   QSGRLPVESLVTSTIRLDDINEAMDHLADGIAVRQLISFTGDL"
     gtgccggcag tgcagccatg gttgtattcc aacatgcctg ccatccgggg cgcggtgcta        60
     gaccagatcg gtgtgccgcg gccctattgg cggtcgaaac caatcagcgt cgtcgagctg       120
     cacctggacc cgcccgaccg cggtgaggtc cttgtccgaa tcgaggctgc gggcgtgtgc       180
     cactccgacc tgtcggtggt cgacggcacc cgggtacggc cggtgccgat cttgctcggt       240
     catgaagccg ctggaatcgt cgagcaggtc ggcgacggcg tcgacggggt cgcggtcggt       300
     cagcgagtcg tgctggtgtt ccttccgcgt tgcggccagt gcgcggcgtg cgcgaccgac       360
     ggtcggacgc cgtgcgaacc gggcagcgcg gccaacaagg ccggcacact gctcggtggc       420
     ggtatccggc tcagccgggg cggccgcccg gtgtaccacc acctcggcgt ctcgggtttc       480
     gcgacccatg tcgtcgtcaa ccgggccagc gtggttccgg tgccgcacga ggtgccgccc       540
     accgtcgctg ccctactcgg gtgcgcggtg ctcaccggtg ggggtgcggt actcaacgtc       600
     ggtgatccgc agcccggcca gtcggtcgcc gtcgtcggcc tcgggggcgt cggtatggca       660
     gcggtgctca ccgctttgac gtatacagac gttcgtgtgg tcgccgtcga tcagctaccc       720
     gaaaagctgt cggccgcaaa ggccttgggc gcccatgaga tctacacacc gcagcaggcc       780
     acggccggcg gggtcaaagc cgccgtggtt gtcgaagccg tcggtcatcc tgccgcgctg       840
     cacaccgcga tcgggcttac cgcgcccgga gggcgcacca tcaccgtcgg gttgccgcca       900
     ccggatgtcc ggatcagctt gtcgccgttg gattttgtca ccgaaggccg gtcactgatc       960
     ggcagctatc tgggttcggc ggtgcccagc cacgacattc cccgcttcgt gtcgttgtgg      1020
     caatcgggcc gtctgccggt ggagtcgctg gtgacgtcaa cgattcggtt ggacgatatc      1080
     aacgaggcga tggaccacct cgccgatggc atcgcggtgc gtcagctcat cagtttcacc      1140
     ggtgatctct aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page