(data stored in ACNUC1104 zone)

EMBL: CP000717.PE169

CP000717.PE169       Location/Qualifiers
FT   CDS_pept        197976..198845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10169"
FT                   /old_locus_tag="TBFG_00167"
FT                   /product="hypothetical integral membrane protein yrbE1B"
FT                   /note="Mapped to H37Rv Rv0168"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10169"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04512"
FT                   /protein_id="ABR04512.1"
FT                   /translation="MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQ
FT                   IAHALRYYRKETLRLIAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   FLASTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFW
FT                   SFLEALIITAIVMVSHCYYGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGV
FT                   DPNFNLTV"
     atgtcgaccg ctgctgtgct gcgcgcccgc ttcccgcggg cggtcgccaa ccttcgtcaa        60
     tatggaggtg cggcggcccg tggattggac gaggccggcc agctcacctg gttcgctttg       120
     accagcatcg ggcagatcgc gcacgcgctg cgctactacc gcaaggagac gctgcggctg       180
     atcgcccaga tcggcatggg taccggcgcg atggccgtcg tcggcggcac ggtcgccatc       240
     gttggctttg tcacgctgtc cggcagctcg ctggtcgcaa tccagggctt cgcgtcgctg       300
     ggcaacatcg gtgtcgaggc gttcaccggg ttcttcgccg cactgatcaa cgtgcgcatc       360
     gccggcccag ttgtcacggg tgtcgccctg gcggccacgg tcggtgcggg tgctacggcc       420
     gagctgggcg cgatgcggat cagcgaggag atcgatgccc tggaagtgat gggcatcaag       480
     tcgatctcgt ttctggcctc cacccggatc atggccgggc tggtggtgat catcccgctg       540
     tacgcgttgg cgatgattat gtcgttcctg tccccgcaga tcaccaccac ggtgctctac       600
     gggcagtcga acggcaccta cgagcattac tttcaaacgt tcctgcgtcc cgacgatgtc       660
     ttttggtcct tcttggaggc cctcatcatc actgcgatcg tcatggtcag ccactgctac       720
     tacgggtacg ccgccggtgg aggccccgtc ggtgtcggcg aggccgtcgg ccgatcgatg       780
     cgtttctcgt tggtctcggt gcaggtcgtt gtcctgtttg cagcgttggc gctctacggt       840
     gtcgacccga acttcaatct cacggtgtag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page