(data stored in ACNUC1104 zone)

EMBL: CP000717.PE171

CP000717.PE171       Location/Qualifiers
FT   CDS_pept        200211..201251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10171"
FT                   /old_locus_tag="TBFG_00169"
FT                   /product="MCE-family protein mce1B"
FT                   /note="Mapped to H37Rv Rv0170"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10171"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04514"
FT                   /protein_id="ABR04514.1"
FT                   /translation="MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSN
FT                   VSGLRQGQFVRASGVEIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIG
FT                   NRYVELKRGEGKGANDLLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIAN
FT                   ALITVFQGQGGTINDILDQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETV
FT                   NNLENLITGLRNHSDQLAGGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQ
FT                   RVELDDLLHKTPTALTALGRANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPT
FT                   GRCTPQ"
     atgaaaatca ctggaaccgt cgtcaaactc ggcatcgtct cggtggtgct gctgttcttc        60
     acggtgatga tcatcgtgat tttcggtcag atgcgcttcg accggactaa tggctatacc       120
     gcggagttca gcaatgtcag cgggctgcgc caaggccagt ttgtccgtgc ttcgggggta       180
     gagatcggca aggtcaaagc actacacctg gtcgacggtg gccgtcgggt tcgggtggag       240
     ttcaatatcg atcgttcggt gccgttgtat cagtccacga ccgcccagat ccgctattcc       300
     gacctgatcg gtaaccggta cgtggagctc aaacggggtg agggcaaggg ggccaacgat       360
     ctgctgccgc caggtggact catcccattg tcccgcacgt caccggcctt ggatctggac       420
     gcgttgatcg gtggtttcaa gccggtgttt cgggcgttgg atcccgcgaa ggtgaacaac       480
     atcgccaacg cgctcatcac cgtcttccag gggcaaggtg gcaccataaa cgacatcctc       540
     gaccagaccg cgcaactgac cagccagatc gcggagcgcg atcaggcgat cggtgaggtt       600
     gtcaagaacc tgaacatcgt gctggacacc acggtcaagc atcgaaaaga gttcgacgag       660
     acggtcaata acttggagaa tctgatcact gggctgagga accactccga ccagttggcc       720
     ggcggcctcg cgcacatcag caacggcgcc ggcacggtgg ccgacctgct tgccgagaat       780
     cgcacgttgg tgcgcaaggc cgtcagctac ctggacgcta ttcagcaacc ggtcatcgac       840
     cagcgcgtcg agttggacga cctgctccac aagacgccga ccgcgttgac ggcgctcgga       900
     cgcgccaacg gaacctacgg cgatttccag aacttctacc tctgcgacct ccagatcaag       960
     tggaacggat tccaagccgg agggccggtc cgcacggtga agctctttag ccagccgacg      1020
     ggtaggtgca cgccgcaatg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page