(data stored in ACNUC1104 zone)

EMBL: CP000717.PE172

CP000717.PE172       Location/Qualifiers
FT   CDS_pept        201248..202795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10172"
FT                   /old_locus_tag="TBFG_00170"
FT                   /product="MCE-family protein mce1C"
FT                   /note="Mapped to H37Rv Rv0171"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04515"
FT                   /protein_id="ABR04515.1"
FT                   /translation="MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQ
FT                   FTDSGGLHKGDRVRIAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILG
FT                   RKVLEIEPRGAQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSE
FT                   TVDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAK
FT                   TLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLA
FT                   ETLTILGRFSASFGETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAG
FT                   LPAYRWPDPNGTRFPNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPL
FT                   PCANLTQGPFGGPDFPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQ
FT                   EAPPGARTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
     atgagaacgc tggaaccacc caaccgaatg cgaattgggc tcatgggcat cgtcgttgcg        60
     ctgctcgttg tcgctgtggg ccaaagcttt accagtgttc ccatgctatt cgcaaagccg       120
     agctactacg gccagttcac cgactccggc ggactgcaca agggcgacag ggtacgcatc       180
     gccggcttgg gagtgggcac cgtggagggg ctcaagatcg acggcgacca catcgtggtc       240
     aagttctcca tcggcaccaa caccatcggc accgagagcc gcctagccat ccgcaccgac       300
     accatcctgg gtaggaaagt gctcgagatc gagccgcgcg gcgcccaagc gttgccgccc       360
     gggggcgttt tgccggttgg gcaaagcacc accccgtacc agatttacga cgcgttcttc       420
     gacgtcacca aggccgcatc cggctgggac atcgagacgg tcaagcggtc gctgaatgtg       480
     ttgtcggaga ccgttgatca gacctatccg cacctgagcg ccgccctcga cggggtggct       540
     aagttctccg acaccatcgg caagcgcgac gagcagatca cgcacctact agcccaggcc       600
     aaccaggtgg ccagcatcct gggtgatcgc agtgagcagg tcgaccgcct attggtcaac       660
     gctaagaccc tgatcgccgc gttcaacgag cgcggccgcg cggtcgacgc cctgctgggg       720
     aacatctccg ctttctcggc ccaggtgcaa aaccttatca acgacaaccc gaacctgaac       780
     catgtgctcg agcagctgcg catcctcacc gacctgttgg tcgaccgcaa ggaggatttg       840
     gctgaaaccc tgacgatctt gggcagattc agcgcgtcgt tcggtgagac gtttgcctct       900
     gggccctact tcaaagtgct gctggccaac ctggtgccgg gtcagatctt gcagccgttt       960
     gtcgatgcgg cattcaagaa gcgtggtatt agcccggagg acttctggcg cagcgccggg      1020
     ctgccggcat accggtggcc cgaccccaat ggcacccggt tccccaacgg tgcgccgccg      1080
     ccaccaccgc cggtgttgga gggcacgccc gagcatcccg ggccggcggt gccgccggga      1140
     tcgccgtgct cctacacccc gccggcggac ggtctgccgc ggccgtggga tccgctgccc      1200
     tgcgctaacc tcactcaagg tccattcggt ggccccgatt tcccggcgcc gctggatgtc      1260
     gcgacgtcgc cgccgaaccc agacggtcca ccgcccgccc cgggcctacc aatcgcggga      1320
     cgtccgggtg aggtgccgcc gaacgttccc ggcacgccgg tgccgattcc acaggaggct      1380
     ccccccgggg cacgcacgct gcccctcggg ccggcgcctg gtccggctcc gcccccggcg      1440
     gcgccaggcc cgccggcacc accgggcccc gggccgcagt tgccggcccc gttcatcaac      1500
     cccggcggca ccggcggtag tggcgtgacg ggaggtagcg agaattga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page