(data stored in ACNUC1104 zone)

EMBL: CP000717.PE179

CP000717.PE179       Location/Qualifiers
FT   CDS_pept        209254..209988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10179"
FT                   /old_locus_tag="TBFG_00177"
FT                   /product="MCE associated membrane protein"
FT                   /note="Mapped to H37Rv Rv0178"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04522"
FT                   /protein_id="ABR04522.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
     gtggaagatc agcagtctgc ttccggtgat ctgacccaaa agtccgttgc caacggagag        60
     tccaccgaca cggcatccgc agccaccgag ggccaccggg gcgagatcga cgccgcggga       120
     gagccggacg aacgcggtgc cgccgtggct gacagccaag ctgacgagga tgattcggcc       180
     gcgacggctg ccaggggcgg caagacacgg gcaagacgat cgcgtggcag gcggttagcg       240
     atcacggtcg gcgtggccgc tgcgttgttc gtgggctcgg cagcgttcgc tggtgcgacg       300
     gtggagccct acctctccga gcgcgccgtg gtggccacca agctcatggt cgcgcggacc       360
     gccgccaatg cgatcacgac gttgtggacc tacacgccgg agaacatgga caccctggcc       420
     gatcgggccg cgaattacct cagcggtgat ttcgcggctc agtaccgcag attcgtcgac       480
     cagatcgccg cagcaaacaa acaggccaag attaccaacg ataccgaggt caccggtgct       540
     gccgtggaat cgctgagcgg ccgggatgcc gttgccatcg tctacaccaa caccacgacc       600
     accagtccgg tgaccaagaa catcccagca ttgaagtatc tgtcctaccg gctgttcatg       660
     aagcgttatg acgcgcggtg gctggtgacc aggatgacga ccatcacctc gctggatttg       720
     acgccgcagg tgtag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page