(data stored in ACNUC1104 zone)

EMBL: CP000717.PE181

CP000717.PE181       Location/Qualifiers
FT   CDS_pept        complement(211208..212566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10181"
FT                   /old_locus_tag="TBFG_00179"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0180c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10181"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04524"
FT                   /protein_id="ABR04524.1"
FT                   /translation="MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYL
FT                   GGILNPMTNLRHFPIALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTA
FT                   AVYGSALIPPTFSSQLRDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALT
FT                   VVNGKVGERLTAEVAAQTGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYA
FT                   LLLLLAGFTGSIVVSTLVDSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLAL
FT                   LTSGVYLAIAHGLGMPIPLGWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVI
FT                   LGLPSAGATVPLEAVPAFFRWLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIG
FT                   LIIGLLLGGFITHLYDRSSFHRIPGAVEMAIAVEHQAQYQARQSARESSSEQP"
     atgtctcaag cgcagccgcg ccccgccgca cccaacccca agcggaacgt caaagcgatt        60
     cggacggtgc gtttctggat ggcaccgatc gccaccacgt tggccctgat gtcggcgctg       120
     gccgcgctct atctgggcgg catcctaaac cccatgacca atttgcggca tttcccaatc       180
     gcgttggtga acgaggacgc cgggcccgcg ggccagcaga ttgtcgacgg tctggtttcc       240
     ggcttggaca agaacaagtt cgacatccga gtggtttcgc cggacgaggc caggcggctg       300
     ctcgacaccg cggcggtgta cggctcggcg ctgataccgc cgaccttctc gtcgcagcta       360
     cgggacttcg gggcgagtgc ggtgacgcca acccgcacag accggcccgc gatcacgatc       420
     tcaacgaatc cgcgggcggg cacgctggca gctagcatcg ccggccagac gctgacccgg       480
     gcactgacgg tggtcaacgg caaagtgggc gagcgactta ccgcggaggt agcggcccag       540
     accggcggtg tggcactggc cggggcggcg gcggccgggc tggccagtcc catcgatgtc       600
     aaatccaccg cctataaccc actgcccaac ggcaccggca acgggctgtc ggcgttttac       660
     tacgccctct tgctgctatt ggcgggcttt accggcagca tcgtggtgag caccctggtg       720
     gactcgatgc ttggctatgt accagccgaa ttcggccccg tctatcgctt cgccgagcag       780
     gtcaacatct ctcgcttccg tacgctgttg gtcaagtggg cggtgatggt ggtgctggcg       840
     ttgctcacct cgggtgtcta cctggcgatc gcccacggcc tgggcatgcc gattccgctc       900
     gggtggcaag tatggctcta cggagtattc gcgatcatag cggtcggcgt cacgtccagc       960
     tcgctgatcg cggtgctggg ctcgatgggc ctgttggtca gcatgttgat cttcgtcatc      1020
     ctcggattgc cgtcggcggg cgcgaccgtc ccgctggaag ccgtaccagc gttcttccgc      1080
     tggttggctc aattcgagcc gatgcaccag gtgttcctag gtgtgcggtc actgctgtat      1140
     ctgaacggaa acgccgacgc cggcctgtcc caggccctga ccatgacgtc gatcgggctg      1200
     atcatcgggc tgttgctggg tggattcatc acacacctgt acgaccgcag cagcttccac      1260
     cgaattccgg gagcggtcga gatggcgatc gccgtggaac accaagctca ataccaagct      1320
     cgccaaagcg cacgcgaaag ctcaagcgaa caaccgtaa                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page