(data stored in ACNUC1104 zone)

EMBL: CP000717.PE182

CP000717.PE182       Location/Qualifiers
FT   CDS_pept        complement(212593..213327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10182"
FT                   /old_locus_tag="TBFG_00180"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0181c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10182"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04525"
FT                   /protein_id="ABR04525.1"
FT                   /translation="MTATVEIRRAADRAVTTTSWLKSRHSFSFGDHYDPDNTHHGLLLV
FT                   NNDDQMEPASGFDPHPHRDMEIVTWVLRGALRHQDSAGNSGVIYPGLAQRMSAGTGILH
FT                   SEMNDSATEPVHFVQMWVIPDATGITASYQQQEIDDELLRAGLVTIASGIPGQDAALTL
FT                   HNSSASLHGARLRPGATVSLPCAPFLHLFVAYGRLTLEGGGELADGDAVRFTDADAHGL
FT                   TANEPSEVLIWEMHAKLGDSAT"
     atgaccgcca ccgtcgagat aaggcgtgcg gccgaccggg cggtcaccac gacgtcctgg        60
     ctgaaatccc ggcattcgtt ctcattcggc gaccactacg atcccgacaa cacccaccac       120
     gggctcctgt tggtgaacaa cgacgaccaa atggaaccgg cttcgggttt tgatccccat       180
     ccacaccgtg acatggaaat cgtgacctgg gtgctgcggg gagcgctcag acaccaggat       240
     tccgccggca atagcggagt gatctatccc ggtctggccc aacgcatgtc ggccggcacc       300
     ggaatcttgc attcggaaat gaacgattct gctaccgagc cggtgcattt cgtgcagatg       360
     tgggtaatac ccgatgcaac cggcatcact gccagctacc aacagcagga gatagacgac       420
     gaactgttgc gcgccggcct ggtaaccatc gcgtcgggca tacccgggca agacgcagcg       480
     ctcaccctgc ataacagcag cgcctcgttg cacggcgcgc ggctgcggcc cggcgctacg       540
     gtcagcctgc cctgcgcacc cttcctgcat ctgttcgtcg cctacggccg cctcactctg       600
     gaaggtggcg gcgagcttgc cgacggggac gcggtgcggt tcaccgacgc tgacgcccac       660
     ggcctgaccg ccaatgagcc gtcggaagta ctgatctggg agatgcacgc gaagctgggc       720
     gattcggcaa catag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page