(data stored in ACNUC1104 zone)

EMBL: CP000717.PE185

CP000717.PE185       Location/Qualifiers
FT   CDS_pept        215285..216034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10185"
FT                   /old_locus_tag="TBFG_00183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0184"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10185"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04528"
FT                   /protein_id="ABR04528.1"
FT                   /translation="MTNDKMLARIAALLRQAEGTDNPHEADAFMSTAQRLATAASIDLA
FT                   VARSHAGNRSPAQAPTQRTITIGAAGTRGLRTYVQLFVLIAAANDVRCDVASNSTFVYA
FT                   YGFAEDIDTSHALYASLVVQMVRASDAYLASGAHRPTPTITARLNFQLAFGARVGQRLA
FT                   DAREQTRQEATKDRDRPPGTAIALRDKDIELHEYYRRSSKARGAWRASRATAGYSSAAR
FT                   RAGDRAGRQARLGNNPELPGARAALGR"
     atgaccaacg acaagatgct ggcccgcatc gcagccctgc tgcgccaggc cgaaggcacc        60
     gacaacccgc acgaggccga cgcgttcatg agcaccgcac aacggttggc cacggcggca       120
     tccatcgacc tggcggtggc ccggtcgcac gcgggcaacc gttcacccgc gcaggccccg       180
     acacagcgca ccatcaccat cggggcggcg ggcacccgcg gattgcggac ctatgtgcag       240
     ctcttcgtgc tcatcgcggc ggccaacgac gtgcgctgcg acgtggcatc gaattcgacg       300
     ttcgtgtacg cctacgggtt cgccgaggac atcgacacca gccacgccct atacgccagc       360
     ctggtggtcc agatggtccg ggcatccgac gcctacctcg cctcgggagc gcaccggccc       420
     acgccgacga tcaccgcccg actcaacttc cagctggcgt tcggcgcccg ggtcggccag       480
     cgcttggccg atgcccgaga gcagactcgg caggaagcca ccaaggaccg tgatcgtccg       540
     cctggtaccg caattgccct gcgggacaag gacatcgagc tgcatgagta ctaccgtcgt       600
     tcctctaagg cgcgcggcgc ctggcgagcc agccgggcca ccgcgggata ctcgtcggcg       660
     gcacggcgcg ccggtgatcg agcgggacgg caagcacgac tcgggaacaa ccccgagctg       720
     cccggggcac gggccgcgct gggccggtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page