(data stored in ACNUC1104 zone)

EMBL: CP000717.PE189

CP000717.PE189       Location/Qualifiers
FT   CDS_pept        219802..220233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10189"
FT                   /old_locus_tag="TBFG_00187"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0188"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10189"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04532"
FT                   /protein_id="ABR04532.1"
FT                   /translation="MSTVHSSIDQHPDLLALRASFDRAAESTIAHFTFGLALLAGLYVA
FT                   ASPWIVGFSATRGLPTCDLIVGIAVAYLAYGFASALDRTHGMTWTLPVLGVWVIFSPWV
FT                   LPGVAVTAGMMWSHIIAGAVVAVLGFYFGMRTRAAANQG"
     atgagtacag tccattcatc aattgatcaa caccctgatt tgttggctct gcgtgccagc        60
     ttcgaccgcg ccgccgagtc gacgatcgcg catttcacat tcggtctggc cctgctggcg       120
     ggcctgtatg tggctgcatc gccgtggatc gtcggcttca gcgccaccag agggctgcca       180
     acgtgtgacc ttatcgtggg gatcgcggtc gcgtacttgg cgtatgggtt cgcgtcggcc       240
     ctggatcgca cacacggcat gacctggacg ctacccgtgc tcggtgtgtg ggtcattttc       300
     tcgccgtggg tgctaccagg ggtcgcggtg acggctggca tgatgtggtc gcacatcatc       360
     gcaggtgcgg tggtagccgt cctgggcttc tacttcggga tgcgcacgcg ggccgcggct       420
     aaccaaggat ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page