(data stored in ACNUC1104 zone)

EMBL: CP000717.PE19

CP000717.PE19        Location/Qualifiers
FT   CDS_pept        complement(23371..23838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10019"
FT                   /old_locus_tag="TBFG_00019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0019c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04362"
FT                   /protein_id="ABR04362.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGL
FT                   ALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP"
     atgcaggggt tggtactgca actgacgcgt gccggattct tgatgttgtt gtgggtattc        60
     atctggtccg tgctacggat cttgaagacc gacatttatg cgccgaccgg cgcggtcatg       120
     atgcgccgcg gcctggcgct gcgagggacg ctcttaggcg cgcgtcagcg ccggcacgct       180
     gcacgctacc tggtggtgac cgaaggtgcg ttgactggcg cgcgtatcac gctgagcgaa       240
     cagccggtgt tgatcgggcg cgccgacgac tcgaccctgg tgctgaccga cgactacgcc       300
     tcgacgcggc acgctcggct gtctatgcgc ggctccgagt ggtacgtcga agatctagga       360
     tcgaccaacg gcacttacct ggacagggcg aaggtgacga ctgcggtacg agttccgatc       420
     ggaacgccgg ttcgcatcgg caaaactgca atcgagttgc gcccgtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page