(data stored in ACNUC1104 zone)

EMBL: CP000717.PE192

CP000717.PE192       Location/Qualifiers
FT   CDS_pept        222605..223846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10192"
FT                   /old_locus_tag="TBFG_00190"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0191"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04535"
FT                   /protein_id="ABR04535.1"
FT                   /translation="MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALS
FT                   AIARNLRVSVVLVGTLLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSA
FT                   LAPNFAVLAAGRVLCAVTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSP
FT                   LTAAMSLMWGWRLAAVCVTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLV
FT                   KVSVLTMIAVTGHFVSYTYIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDR
FT                   WPKGAVIVGMTGLTAAFTLLTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAA
FT                   MRSGGDDPDGASGLYVTAFQIGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVS
FT                   QHLFENPTLSPGDG"
     atgactgccc caaccggaac ctccgccact acgacgcgac cgtggacgcc acggatcgcc        60
     acgcaactgt ccgtgctggc ttgcgcggcc tttatctatg tcaccgccga aatcctgcca       120
     gtgggcgcgc tgtcggcgat agcgcggaac ttgcgcgtca gcgtggtcct agttgggacc       180
     ttgctgtcct ggtatgccct tgtcgcggcc gtgacaacgg ttccgctggt gcgttggacc       240
     gcacactggc cgcgccgccg ggccctggtg gtcagcctgg tctgcctgac cgtctcgcaa       300
     ctcgtctcgg cgctggcgcc caacttcgcg gtgctggccg ccgggcgggt gctctgcgcg       360
     gtcacccatg gcctgctgtg ggcggtcatc gcgccgatcg ccacccggct ggtgccgccc       420
     agtcacgccg ggcgcgccac gacgtcgatc tacatcggaa ccagtctggc gctggtcgtc       480
     ggtagcccac tcacggctgc catgagcctg atgtggggtt ggcggctggc ggcggtgtgc       540
     gtgaccggcg cggcggccgc ggtcgccctg gccgcccggc tggcgttgcc ggagatggtg       600
     ctgcgcgccg accagctcga gcacgttggc cgacgggctc gtcaccaccg taatcctcgc       660
     ctggtcaagg tcagtgtgct cacgatgatc gcggtaaccg gccatttcgt gtcctacacc       720
     tacatcgtgg tgatcatccg cgacgtcgtc ggtgtacgtg ggccgaatct ggcctggctg       780
     ctcgccgcct atggggtcgc cggcctggtg tccgtgcccc tggtggcgcg gccgttggac       840
     cgttggccca agggcgccgt catcgtcggt atgaccggac tgacggcggc gttcaccttg       900
     ctgaccgcgc tggcattcgg tgaacgccac accgcggcga cggcactgct gggcaccggt       960
     gcgattgtgc tgtggggagc cttggccact gccgtgtcac cgatgctgca atcggcggcg      1020
     atgcgtagcg gcggcgacga ccccgacggg gcctcaggtt tgtatgtgac ggcgtttcag      1080
     atcggcatca tggccggcgc tctgctgggt gggctgctct acgagcgcag cttggcgatg      1140
     atgctgaccg cgtcggcggg tttgatgggt gttgcgttgt tcgggatgac ggttagccag      1200
     cacttgttcg agaatccgac tctgagtccc ggcgacggct aa                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page