(data stored in ACNUC1104 zone)

EMBL: CP000717.PE194

CP000717.PE194       Location/Qualifiers
FT   CDS_pept        224315..224980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10194"
FT                   /old_locus_tag="TBFG_00191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0192"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10194"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04537"
FT                   /protein_id="ABR04537.1"
FT                   /translation="MVGVAKPIVINFAVPIADRAMAESAIHISSIPPVPGKFYWMSPTQ
FT                   VRWRPFEFWPANTAVNIDAAGTKSSFRTGDSLVATADDATHQMTITRNGVVQKTFPMSM
FT                   GMVSGGHQTPNGTYYVLEKFATVVMDSSTYGVPVNSAQGYKLTVSDAVRIDNSGNFVHS
FT                   APWSVADQGKRNVTHGCINLSPANAKWFYDNFGSGDPVVVKNSVGTYNKNDGAQDWQI"
     atggtcggtg tggccaagcc gatcgtcatc aacttcgcgg tgccgatcgc cgaccgggcg        60
     atggccgaaa gcgccatcca catttcgtcc atcccgcccg tgccgggcaa gttctactgg       120
     atgagcccga ctcaggtacg ctggcgcccg tttgagttct ggcccgccaa caccgcggta       180
     aacatcgatg cggccggcac caagtcgagc ttccggaccg gtgattcgct ggtggccacc       240
     gccgacgacg ccacgcatca gatgacaatc acccgcaacg gcgtcgtgca aaagaccttc       300
     cccatgtcga tgggcatggt gtccggcggc caccagaccc cgaatggcac ctactacgtg       360
     cttgagaagt tcgccaccgt ggtcatggac tcctcgacgt acggggtccc ggtcaactcg       420
     gcccaaggct acaagttgac cgtctccgac gccgtccgga tcgacaacag cggcaacttc       480
     gtgcacagcg cgccgtggtc ggtggcagat cagggcaagc gcaacgtcac ccacggctgc       540
     atcaacctca gcccggccaa cgcgaagtgg ttctacgaca acttcggcag cggtgacccg       600
     gtcgtcgtga agaactctgt cgggacttac aacaaaaacg acggtgccca ggactggcag       660
     atctaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page