(data stored in ACNUC1104 zone)

EMBL: CP000717.PE196

CP000717.PE196       Location/Qualifiers
FT   CDS_pept        227194..230778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10196"
FT                   /old_locus_tag="TBFG_00193"
FT                   /product="hypothetical drugs-transport transmembrane
FT                   ATP-binding protein ABC transporter"
FT                   /note="Mapped to H37Rv Rv0194"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10196"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04539"
FT                   /protein_id="ABR04539.1"
FT                   /translation="MRTNCWWRLSGYVMRHRRDLLLGFGAALAGTVIAVLVPLVTKRVI
FT                   DDAIAADHRPLAPWAVVLVAAAGATYLLTYVRRYYGGRIAHLVQHDLRMDAFQALLRWD
FT                   GRQQDRWSSGQLIVRTTNDLQLVQALLFDVPNVLRHVLTLLLGVAVMTWLSVPLALLAV
FT                   LLVPVIGLIAHRSRRLLAAATHCAQEHKAAVTGVVDAAVCGIRVVKAFGQEERETVKLV
FT                   TASRALYAAQLRVARLNAHFGPLLQTLPALGQMAVFALGGWMAAQGSITVGTFVAFWAC
FT                   LTLLARPACDLAGMLTIAQQARAGAVRVLELIDSRPTLVDGTKPLSPEARLSLEFQRVS
FT                   FGYVADRPVLREISLSVRAGETLAVVGAPGSGKSTLASLATRCYDVTQGAVRIGGQDVR
FT                   ELTLDSLRSAIGLVPEDAVLFSGTIGANIAYGRPDATPEQIATAARAAHIEEFVNTLPD
FT                   GYQTAVGARGLTLSGGQRQRIALARALLHQPRLLIMDDPTSAVDAVIECGIQEVLREAI
FT                   ADRTAVIFTRRRSMLTLADRVAVLDSGRLLDVGTPDEVWERCPRYRELLSPAPDLADDL
FT                   VVAERSPVCRPVAGLGTKAAQHTNVHNPGPHDHPPGPDPLRRLLREFRGPLALSLLLVA
FT                   VQTCAGLLPPLLIRHGIDVGIRRHVLSALWWAALAGTATVVIRWVVQWGSAMVAGYTGE
FT                   QVLFRLRSVVFAHAQRLGLDAFEDDGDAQIVTAVTADVEAIVAFLRTGLVVAVISVVTL
FT                   VGILVALLAIRARLVLLIFTTMPVLALATWQFRRASNWTYRRARHRLGTVTATLREYAA
FT                   GLRIAQAFRAEYRGLQSYFAHSDDYRRLGVRGQRLLALYYPFVALLCSLATTLVLLDGA
FT                   REVRAGVISVGALVTYLLYIELLYTPIGELAQMFDDYQRAAVAAGRIRSLLSTRTPSSP
FT                   AARPVGTLRGEVVFDAVHYSYRTREVPALAGINLRIPAGQTVVFVGSTGSGKSTLIKLV
FT                   ARFYDPTHGTVRVDGCDLREFDVDGYRNRLGIVTQEQYVFAGTVRDAIAYGRPDATDAQ
FT                   VERAAREVGAHPMITALDNGYLHQVTAGGRNLSAGQLQLLALARARLVDPDILLLDEAT
FT                   VALDPATEAVVQRATLTLAARRTTLIVAHGLAIAEHADRIVVLEHGTVVEDGAHTELLA
FT                   AGGHYSRLWAAHTRLCSPEITQLQCIDA"
     atgcgcacga attgctggtg gcggttgtcc ggctatgtca tgcggcatcg gcgcgatctg        60
     ctgttgggat tcggggcggc gctggccggc accgtcatcg ccgttttggt tccgctggta       120
     accaagcgtg tcatagacga cgcgatcgcg gccgaccaca gaccgctggc gccctgggcc       180
     gtggttctgg tcgccgccgc cggggcgacc tacttgctga cgtacgtacg ccggtactac       240
     ggcggtcgaa ttgcccacct ggtacagcat gacctgcgca tggacgcctt tcaggccctg       300
     ttgcggtggg acggccgaca acaggaccgg tggagcagcg gccagctcat cgtccgcacc       360
     accaatgacc tgcaactggt gcaggcgttg ctgttcgatg tgcccaatgt gctcaggcat       420
     gtgctgacac tgctactagg tgtcgcggtc atgacctggt tgtcggtgcc gcttgcgctg       480
     cttgcggtgc tgctggtacc cgtgattggc ctgatcgccc accgcagccg ccggctgctg       540
     gccgcagcca cccactgtgc ccaggaacac aaggccgcgg tcaccggagt cgtcgatgcg       600
     gcggtctgcg gaatccgggt cgtcaaggcg ttcgggcagg aggagcggga gacggtcaag       660
     ctggtgacgg catcccgcgc gctctatgct gcccagctgc gggtggccag gctcaacgca       720
     cacttcggtc cgctgctgca aaccctgccc gcgttgggtc agatggcggt cttcgcgctc       780
     ggcggatgga tggccgcgca gggcagcatt acggtgggca cctttgttgc cttctgggcc       840
     tgcctgacat tgctggcgcg gccggcatgc gatctggcgg ggatgctgac cattgcccag       900
     caggcgcgcg ccggcgcggt gcgggtactc gaactcatcg acagccggcc gacgctggtt       960
     gacggcacca agccgctgtc gccggaggct cggttatcac tggagttcca gcgggtgtcc      1020
     ttcggatatg tggctgaccg ccccgtgctc cgcgagataa gcctgtcggt ccgggccggg      1080
     gagaccctgg cggtggtcgg tgcgccgggc agcggcaaat ccacgttggc gtcgctggcg      1140
     acgcgttgct acgacgtcac acagggcgcg gtgcggatcg gtggtcagga tgtgcgcgag      1200
     ctgacgctcg actcgctgcg gtcagccatc ggcctggtac ccgaagatgc cgtcctgttc      1260
     tccggaacga tcggtgcaaa catcgcctat ggccgcccgg atgcgacgcc cgaacagatt      1320
     gccacggcgg cccgggcggc gcacatcgag gagttcgtca acactctgcc ggacgggtat      1380
     cagacggccg tcggtgcgcg cggactgacg ctgtccggcg ggcaacgcca acgcatcgcc      1440
     ctggcccggg cgctactgca ccagccgcgg ttgttgatca tggacgaccc gacctctgcc      1500
     gtggatgcgg tcatcgaatg cggaattcag gaggtgctgc gggaggcgat cgcggatcgc      1560
     accgcggtca ttttcacccg ccgccgatcc atgcttacct tggccgaccg ggtcgcggtc      1620
     ctcgactccg ggcgcctgct cgatgtcggc acccccgacg aggtgtggga gcgctgtccc      1680
     cgctatcggg aattgctgtc gcccgcgccg gatctcgccg atgacctggt tgtcgcggag      1740
     cgctcgccgg tgtgtcgacc ggtggccggg ctcggcacca aggccgcgca gcacaccaac      1800
     gtccacaacc ccgggcctca cgatcaccca cccggccccg acccgttacg ccgcctgctg      1860
     cgtgagttcc gcggcccgct tgcgttgagc ctgctgttgg tggccgtgca gacctgcgcg      1920
     ggtctgctgc cgcccctgct catccgccac ggtattgacg tcgggattcg ccgccatgtg      1980
     ctctcggcgc tttggtgggc agcgctcgcc ggcaccgcca ccgtggtcat taggtgggtc      2040
     gtgcagtggg ggagtgccat ggtcgccgga tacaccggtg agcaggtgct gtttcgattg      2100
     cggtccgtcg tcttcgccca tgcccagcgc ctgggcctgg acgcatttga agacgacgga      2160
     gatgcccaga tcgtcaccgc ggtcaccgcc gacgtcgagg ccatcgtggc gttcctgcgc      2220
     acgggtctgg tcgttgccgt gatcagcgtg gtgaccctgg tcggcatttt ggtggcgctg      2280
     ctggccatcc gcgcccggct ggtgttgctg atcttcacca ccatgccggt gcttgccctt      2340
     gcgacctggc aattccgtcg ggcgtcgaat tggacctatc ggcgggcgcg gcaccggttg      2400
     gggacggtaa ccgccacgtt gcgtgagtac gcggcggggt tgcggatcgc ccaggcgttc      2460
     cgcgccgaat accggggact gcaaagctat ttcgctcata gtgacgacta tcgccgactt      2520
     ggggtgcgcg ggcagcggct gctagccctg tactacccgt tcgtggcatt gctctgcagc      2580
     ctggcgacca ccctggtcct gctcgacggt gcacgcgagg tgcgagcggg ggtgatctcg      2640
     gtcggagcgc tggtgaccta tctgctctac atcgagctgt tgtacacgcc gataggcgaa      2700
     ctggcgcaaa tgttcgacga ttaccagcgt gcggcggtgg cggccgggcg gatccggtcg      2760
     ctgctgagca cgcggacacc gtcgtcgccg gcggcacgac cggtggggac gttgcgtggt      2820
     gaagtggttt tcgacgccgt ccactattcc taccgaacac gagaagtgcc ggcactggcc      2880
     ggcatcaacc tgcgaattcc ggccgggcag acggtggtgt tcgtcggctc caccggatcc      2940
     gggaaatcca ccctgatcaa gttggtggcg cggttctacg atccgaccca tgggacggtc      3000
     cgagtcgacg gatgcgacct gcgggagttc gatgtcgacg gctatcgcaa ccggctcggc      3060
     atcgtgacgc aggagcagta cgtcttcgcc gggacggtcc gcgatgccat cgcatacgga      3120
     cggcccgatg ccaccgatgc ccaggtcgaa cgggctgcgc gggaggtcgg tgcccatccg      3180
     atgatcaccg cactcgacaa cgggtacctg catcaggtca ccgcgggtgg gcgcaatctg      3240
     tccgccggtc agctgcagtt gctcgcattg gccagggcgc gtctggttga ccccgacatt      3300
     ctgctgctgg atgaggccac cgtggccctg gatcctgcca ccgaggccgt ggtgcagcgg      3360
     gccaccctca ccctggcagc ccgtcggacg accttgatcg tggctcacgg gctagccatc      3420
     gccgaacacg ccgaccgcat tgtcgtgctc gagcacggca ccgttgtcga ggacggcgcc      3480
     cacaccgaac ttctcgctgc tgggggccac tattcgcggc tgtgggcggc ccatactcga      3540
     ctgtgttcgc cggaaatcac tcagcttcaa tgtattgacg catag                      3585
//

If you have problems or comments...

PBIL Back to PBIL home page