(data stored in ACNUC1104 zone)

EMBL: CP000717.PE197

CP000717.PE197       Location/Qualifiers
FT   CDS_pept        231152..231850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10197"
FT                   /old_locus_tag="TBFG_00194"
FT                   /product="two component transcriptional regulatory protein,
FT                   luxR-family"
FT                   /note="Mapped to H37Rv Rv0195"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10197"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04540"
FT                   /protein_id="ABR04540.1"
FT                   /translation="MVKRSGAKFREEFILRPDRVQMAPVNVISVAVVASDPLTRDGALA
FT                   RLSSHRELDVRAWQAGCETSVLLVLATTITAPLLCQIEDVQKDGPSHAPKLVVVADEFS
FT                   AEQVFRMIKLGLTGLLYRSQSTFDCIVETIRLSAEGRLRLPERVQRYLVGRIKSTPTAE
FT                   PDTPCAAALAEREVAVLRLLADGLSTHQVAVQLNYCERTIKNIVHDIVTRLKLRNRTHA
FT                   VAHALRAGLI"
     gtggtcaagc gcagcggagc gaaattccgc gaggagttca tcctccgtcc ggaccgggtg        60
     caaatggcac cggtgaatgt catttcggtc gcggtggtgg cgagcgaccc gttgacccgc       120
     gatggagctt tggcccgact ctcgtctcac cgggagctcg acgtgcgcgc ttggcaggct       180
     ggatgcgaaa cctcggtcct gctcgtgctg gccaccacga tcaccgcgcc tcttctatgc       240
     cagatcgagg acgtgcagaa ggatggcccc agtcacgcgc cgaaactggt cgtcgtcgcc       300
     gacgaattct ccgctgaaca agttttccgg atgatcaagc tggggttgac cgggttgttg       360
     tatcgcagcc agagcacgtt cgactgcatc gtcgagacaa tccggttgtc cgccgaaggc       420
     cgcctgcgac tccccgaacg tgtccagcgt tacctggtcg gccgcatcaa gtccaccccg       480
     accgccgaac ctgacacacc gtgcgccgcc gctcttgccg agcgtgaggt ggcggtgctg       540
     cgtctgctag cggacggctt gagcacgcac caagtggcgg tgcagctcaa ctattgcgag       600
     cgcacgatca agaacatcgt tcatgacata gtgacgcggc tgaagctccg caaccgcacg       660
     catgccgtcg cacatgcgct gcgcgcgggc ctcatttga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page