(data stored in ACNUC1104 zone)

EMBL: CP000717.PE198

CP000717.PE198       Location/Qualifiers
FT   CDS_pept        231963..232547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10198"
FT                   /old_locus_tag="TBFG_00195"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0196"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04541"
FT                   /protein_id="ABR04541.1"
FT                   /translation="MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGEHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSV
FT                   EAGDEQDRERMAPVIARAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAIL
FT                   LARVRRDLTPLDLVHRQLRNLLLAELPERSR"
     atgcaaggtc cacgcgaacg gatggtggtc tcggccgcgc tgttgattcg ggaacgggga        60
     gcccacgcca ccgccatctc ggatgtgctg cagcacagcg gcgcaccgcg ggggtcggcc       120
     tatcactact tcccgggcgg tcgtacccaa ctgctatgcg aggccgtcga ttacgccgga       180
     gagcatgtcg ccgccatgat caacgaggcc gaggggggcc tggagctgct ggacgcgctg       240
     attgacaagt atcgccagca gctgctcagc accgactttc gcgccggctg cccgatcgcc       300
     gcggtctcgg tggaggcggg cgacgaacaa gatcgcgagc ggatggcccc ggtgatcgcg       360
     cgtgcagcgg cggtgtttga ccgctggtcg gacttgactg cccagcggtt cattgccgac       420
     ggcataccgc cggatcgggc gcacgagctg gcggtgttgg cgacgtcgac gctcgagggc       480
     gcaatcttgc tggctcgggt gcggcgcgac ctgacgccgc tggatctggt tcaccgccag       540
     ctgcgcaacc tgctgctggc cgagctgccc gaaaggagcc gatga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page