(data stored in ACNUC1104 zone)

EMBL: CP000717.PE2

CP000717.PE2         Location/Qualifiers
FT   CDS_pept        2153..3361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10002"
FT                   /old_locus_tag="TBFG_00002"
FT                   /product="DNA polymerase III beta subunit dnaN (DNA
FT                   nucleotidyltransferase)"
FT                   /note="Mapped to H37Rv Rv0002"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10002"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04345"
FT                   /protein_id="ABR04345.1"
FT                   /translation="MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGV
FT                   LLTGSDNGLTISGFDYEVSAEAQVGAEIVSPGSVLVSGRLLSDITRALPNKPVDVHVEG
FT                   NRVALTCGNARFSLPTMPVEDYPTLPTLPEETGLLPAELFAEAISQVAIAAGRDDTLPM
FT                   LTGIRVEILGETVVLAATDRFRLAVRELKWSASSPDIEAAVLVPAKTLAEAAKAGIGGS
FT                   DVRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELI
FT                   EAIKLVALVADRGAQVRMEFADGSVRLSAGADDVGRAEEDLVVDYAGEPLTIAFNPTYL
FT                   TDGLSSLRSERVSFGFTTAGKPALLRPVSGDDRPVAGLNGNGPFPAVSTDYVYLLMPVR
FT                   LPG"
     atggacgcgg ctacgacaag agttggcctc accgacttga cgtttcgttt gctacgagag        60
     tctttcgccg atgcggtgtc gtgggtggct aaaaatctgc cagccaggcc cgcggtgccg       120
     gtgctctccg gcgtgttgtt gaccggctcg gacaacggtc tgacgatttc cggattcgac       180
     tacgaggttt ccgccgaggc ccaggttggc gctgaaattg tttctcctgg aagcgtttta       240
     gtttctggcc gattgttgtc cgatattacc cgggcgttgc ctaacaagcc cgtagacgtt       300
     catgtcgaag gtaaccgggt cgcattgacc tgcggtaacg ccaggttttc gctaccgacg       360
     atgccagtcg aggattatcc gacgctgccg acgctgccgg aagagaccgg attgttgcct       420
     gcggaattat tcgccgaggc aatcagtcag gtcgctatcg ccgccggccg ggacgacacg       480
     ttgcctatgt tgaccggcat ccgggtcgaa atcctcggtg agacggtggt tttggccgct       540
     accgacaggt ttcgcctggc tgttcgagaa ctgaagtggt cggcgtcgtc gccagatatc       600
     gaagcggctg tgctggtccc ggccaagacg ctggccgagg ccgccaaagc gggcatcggc       660
     ggctctgacg ttcgtttgtc gttgggtact gggccggggg tgggcaagga tggcctgctc       720
     ggtatcagtg ggaacggcaa gcgcagcacc acgcgacttc ttgatgccga gttcccgaag       780
     tttcggcagt tgctaccaac cgaacacacc gcggtggcca ccatggacgt ggccgagttg       840
     atcgaagcga tcaagctggt tgcgttggta gctgatcggg gcgcgcaggt gcgcatggag       900
     ttcgctgatg gcagcgtgcg gctttctgcg ggtgccgatg atgttggacg agccgaggaa       960
     gatcttgttg ttgactatgc cggtgaacca ttgacgattg cgtttaaccc aacctatcta      1020
     acggacggtt tgagttcgtt gcgctcggag cgagtgtctt tcgggtttac gactgcgggt      1080
     aagcctgcct tgctacgtcc ggtgtccggg gacgatcgcc ctgtggcggg tctgaatggc      1140
     aacggtccgt tcccggcggt gtcgacggac tatgtctatc tgttgatgcc ggttcggttg      1200
     ccgggctga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page