(data stored in ACNUC1104 zone)

EMBL: CP000717.PE202

CP000717.PE202       Location/Qualifiers
FT   CDS_pept        237524..238213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10202"
FT                   /old_locus_tag="TBFG_00199"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0200"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04545"
FT                   /protein_id="ABR04545.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
     atgagaaatg cttggcggct ggtggtgttc gatgtcctgg caccactggc cacgatcgcc        60
     gccctggccg cgatcggcgt cttgctcggc tggcccctgt ggtgggtttc gacgtgctcg       120
     gtgttggtgc tgctggtggt cgaaggtgtg gcaatcaact tctggctgtt gcgtcgtgat       180
     tcggtaaccg tcggtaccga cgacgatgcg cccgggctgc gactggccgt tgtcttcctg       240
     tgcgccgccg cgatctcggc ggcggtggtg actgggtacc tgcgctggac gacaccggac       300
     cgcgacttca atcgggattc ccgggaagtg gtgcatcttg ccacggggat ggccgagacg       360
     gtcgcgtcat tctccccgag cgcaccggcc gccgctgttg accgggccgc ggcgatgatg       420
     gtgcccgaac atgcgggcgg gttcaaggag caatacgcca agtccagcgc cgatctcgca       480
     cggcgcggtg ttacggccca ggccgctacg ctggcggccg gcgtggaggc gatcgggccg       540
     tcggcagcca gtgttgcggt gattctgcgg gttagccaaa gcattcccgg ccagccgacc       600
     agtcaagcgg cgcgagcgct gcgggtgacc ttgaccaagc ggggcagcgg ctggctggtg       660
     ctcgacgtga cgccgatcaa cgctcgctaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page