(data stored in ACNUC1104 zone)

EMBL: CP000717.PE204

CP000717.PE204       Location/Qualifiers
FT   CDS_pept        complement(238710..241610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10204"
FT                   /old_locus_tag="TBFG_00201"
FT                   /product="transmembrane transport protein mmpL11"
FT                   /note="Mapped to H37Rv Rv0202c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04547"
FT                   /protein_id="ABR04547.1"
FT                   /translation="MMRLSRNLRRCRWLVFTGWLLALVPAVYLAMTQSGNLTGGGFEVA
FT                   GSQSLLVHDQLDAHYPDRGAPALALVAAPRPDASYQDIDNAVALLRQIASELPGVTEAP
FT                   NPTQRPPQPDRPYVVSLRLDARNAGTSDVAKKLRDRIGVKGDQSGQTANGKVRLYVIGQ
FT                   GALSAAAAANTKHDIANAERWNLPIILMVLVAVFGSLAAAAIPLALAVCTVVITMGLVF
FT                   VLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRYREELRCGRRPPDAVDAAMATSGLA
FT                   VVLSGMTVIASLTGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALVHWSRRPASTQSWFWSRWVGWVMRRPWITALAASTVLLVMAAPATLMVLGNSLLRQ
FT                   FDSSHEIRTGAAAAAQALGPGALGPVQVLVRFDAGGASAPEHSQTIAAIRHRIAQAPNV
FT                   VSVAPPRFADDNGSALLSAVLSVDPEDLGARDTITWMRTQLPRVAGAAQVDVGGPTALI
FT                   KDFDDRVSATQPLVLVFVAVIAFLMLLISIRSVFLAFKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWARGLGFPALHSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGQTRDAVAYG
FT                   VRTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATVVRLVLVPALMAM
FT                   FDRWNWWLPRWLAHILPSVDFDRPLPKVDLGDVVVIPDDFAAAIPPSADVRMVLKSAAK
FT                   LKRLAPDAICVTDPLAFTGCGCDGKALDQVQLAYRNGIARAISWGQRPVHPVTVWRKRL
FT                   AVALDALQTTTWECGGVQTHRAGPGYRRRSPVETTNVALPTGDRLQIPTGAETLRFKGY
FT                   LIMSRNSSHDYADFADLVDTMAPETAAAVLAGMDRYYSCQAPGRQWMATQLVGRLADPQ
FT                   PSDLGDQSPGADAQAKWEEVRRRCLSVAVAMLEEAR"
     atgatgcgct tgagccgcaa cctgcgcagg tgccgttggt tggtcttcac gggttggttg        60
     ctggcgttag tgccggcggt ttacctggcg atgacgcagt cggggaatct aaccggtggc       120
     ggtttcgaag tcgccgggtc gcagtcattg ctggtccacg accaactcga cgcgcactac       180
     ccggaccggg gagccccggc gctggcgctg gtagcggccc cccgaccgga tgctagctac       240
     caagacatcg acaatgccgt cgcgctactg cgacaaatag ccagcgaact gcctggggtg       300
     acggaggcac ccaaccccac ccaacggccc ccgcaaccgg accggccgta tgtggtgtcg       360
     ctgcggctgg acgcccgcaa cgcgggcacc agtgacgtcg ccaaaaagct gcgcgaccga       420
     ataggcgtca aaggcgatca gtccgggcaa actgccaacg gcaaagtgcg gctctatgtc       480
     atcgggcagg gcgcgctgtc cgcggccgcg gcggcaaaca ccaaacacga tattgccaac       540
     gccgaacgct ggaacctgcc tatcattctg atggtcctgg ttgcggtttt cggctcgttg       600
     gccgccgcag cgatcccgct ggcactcgcc gtttgcacgg tcgtcatcac catgggcctg       660
     gtgtttgtgt tgtcgatgca caccaccatg tcggtgttcg tgacatcgac cgtttcgatg       720
     ttcggcatcg cgcttgccgt cgactactcc ctgttcatcc tgatgcgcta ccgcgaggaa       780
     ctgcgttgcg gacgccggcc gcccgacgcg gtcgacgccg cgatggccac ttcggggttg       840
     gctgtggtgt tgtccggtat gacggtcatc gcgtcgctga ccgggatcta cctgatcaac       900
     accccggcgc tgagatcgat ggccaccggg gcgattctcg cggtcgcggt tgcgatgctg       960
     acgtcggcca ccctgacacc tgccgtgcta gcaacatttg cccgcgcggc ggccaagcgg      1020
     tcagcgttag tgcactggtc gcggcggccg gcaagcacgc aatcttggtt ctggtcccgc      1080
     tgggtcgggt gggtgatgcg ccgaccctgg atcacagcac tggcggcatc gaccgtgctg      1140
     cttgtcatgg cggcaccggc aaccttgatg gtgctgggca acagcttgct gcgccagttc      1200
     gactcgtcac acgagatccg caccggcgca gcggccgcgg cccaagcgct ggggccgggc      1260
     gcgctgggcc cggttcaggt gctggtcagg tttgacgccg gcggtgcgtc cgcacccgaa      1320
     catagccaga caatcgccgc aatccgtcat cggatcgcac aggcgcccaa cgtcgtttcg      1380
     gtggccccac cgcgattcgc cgacgacaac ggcagcgctt tgctcagcgc ggtgctatcg      1440
     gtcgatcccg aggatttggg cgcccgcgac accatcacct ggatgcggac ccagctaccc      1500
     cgggttgccg gcgcggcaca agtggacgtc ggcgggccga ccgctctgat caaggatttc      1560
     gacgaccggg tgtccgcgac gcaaccgctg gtgctggtct tcgtggcggt gatcgcgttt      1620
     ttgatgttgt tgatctcaat ccgctcggtg ttcctggcgt tcaagggcgt gctgatgacg      1680
     ctgctgtcgg tggccgccgc ctacggcagc ctggtgatgg tcttccagtg gggctgggca      1740
     cgggggctcg gtttcccggc gcttcattcg atcgacagca ccgttccccc gctggtcctg      1800
     gcgatgacgt tcgggttgtc gatggactat gaaatcttcc tgcttacgcg aatccgggag      1860
     cggttcctgc agacgggcca gacccgcgac gcggtcgcgt acggtgtgcg caccagcgcg      1920
     cgcacgatca ccagcgccgc gttgatcatg atcgcggtgt tttgcgggtt cgcgttcgcc      1980
     ggcatgccgc tagtggccga gatcggcgtg gcgtgcgcgg tcgcgatcgc cgtggacgcc      2040
     accgtcgtgc ggctggtgct ggtaccggca ttgatggcga tgtttgaccg atggaactgg      2100
     tggttgcccc gatggctggc ccacatcttg ccgtcggtcg acttcgaccg accgctgccg      2160
     aaagtcgacc tcggtgacgt cgtggtcatt cctgacgact tcgccgcggc gatcccgccc      2220
     agcgcggatg tgcggatggt gctcaagtcg gcggccaagc tcaagcgact tgcgccggac      2280
     gccatttgcg ttaccgatcc gctcgccttc accgggtgtg gatgtgacgg taaggcgctc      2340
     gaccaggtgc agctggccta ccgcaacggc atcgcccggg cgatatcatg gggccagcgc      2400
     ccggtgcacc cggtcaccgt gtggcgcaag cggctcgcgg tcgccctcga cgcgcttcag      2460
     acaaccacct gggagtgcgg gggggtgcag actcaccggg cgggccccgg ctaccggcgg      2520
     cgcagcccgg tggagacgac caacgtcgca ttgcccaccg gtgaccgctt gcagatccca      2580
     accggcgcgg aaacgctgcg cttcaagggc tacctgatca tgtcccgaaa cagcagccac      2640
     gactacgccg actttgctga cctggtcgat acgatggcac ccgaaaccgc cgccgcggtg      2700
     ctggctggga tggatcggta ctactcttgt caagcacccg ggcggcaatg gatggccacc      2760
     cagttggttg gtcgcctggc agatccgcaa ccgtctgacc tcggtgacca gtcgcccgga      2820
     gctgatgccc aggcaaagtg ggaagaggtc cggcggcgtt gcctgtcggt ggccgtggcg      2880
     atgttggagg aggcgaggtg a                                                2901
//

If you have problems or comments...

PBIL Back to PBIL home page