(data stored in ACNUC1104 zone)

EMBL: CP000717.PE205

CP000717.PE205       Location/Qualifiers
FT   CDS_pept        241832..242242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10205"
FT                   /old_locus_tag="TBFG_00202"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0203"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04548"
FT                   /protein_id="ABR04548.1"
FT                   /translation="MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASE
FT                   VARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASDLHAL
FT                   SQPLTDLSTRCSLPISGLQAIGLMQAVQGARR"
     atgaagacag gcaccgcgac gacgcggcgc aggctgttgg cagtactgat cgccctcgcg        60
     ttgccggggg ccgccgttgc gctgctggcc gaaccatcag cgaccggcgc gtcggacccg       120
     tgcgcggcca gcgaagtggc gaggacggtc ggttcggtcg ccaagtcgat gggcgactac       180
     ctggattcac acccagagac caaccaggtg atgaccgcgg tcttgcagca gcaggtaggg       240
     ccggggtcgg tcgcatcgct gaaggcccat ttcgaggcga atcccaaggt cgcatcggat       300
     ctgcacgcgc tttcgcaacc gctgaccgat ctttcgactc ggtgctcgct gccgatcagc       360
     ggcctgcagg cgatcggttt gatgcaggcg gtgcagggcg cccgccggta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page