(data stored in ACNUC1104 zone)

EMBL: CP000717.PE208

CP000717.PE208       Location/Qualifiers
FT   CDS_pept        complement(244802..247636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10208"
FT                   /old_locus_tag="TBFG_00205"
FT                   /product="transmembrane transport protein mmpL3"
FT                   /note="Mapped to H37Rv Rv0206c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04551"
FT                   /protein_id="ABR04551.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVMVALCLGGGVFGLSLGKHVTQSGFYD
FT                   DGSQSVQASVLGDQVYGRDRSGHIVAIFQAPAGKTVDDPAWSKKVVDELNRFQQDHPDQ
FT                   VLGWAGYLRASQATGMATADKKYTFVSIPLKGDDDDTILNNYKAIAPDLQRLDGGTVKL
FT                   AGLQPVAEALTGTIATDQRRMEVLALPLVAVVLFFVFGGVIAAGLPVMVGGLCIAGALG
FT                   IMRFLAIFGPVHYFAQPVVSLIGLGIAIDYGLFIVSRFREEIAEGYDTETAVRRTVITA
FT                   GRTVTFSAVLIVASAIGLLLFPQGFLKSLTYATIASVMLSAILSITVLPACLGILGKHV
FT                   DALGVRTLFRVPFLANWKISAAYLNWLADRLQRTKTREEVEAGFWGKLVNRVMKRPVLF
FT                   AAPIVIIMILLIIPVGKLSLGGISEKYLPPTNSVRQAQEEFDKLFPGYRTNPLTLVIQT
FT                   SNHQPVTDAQIADIRSKAMAIGGFIEPDNDPANMWQERAYAVGASKDPSVRVLQNGLIN
FT                   PADASKKLTELRAITPPKGITVLVGGTPALELDSIHGLFAKMPLMVVILLTTTIVLMFL
FT                   AFGSVVLPIKATLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTAPVIGLIIALVF
FT                   GLSTDYEVFLVSRMVEARERGMSTQEAIRIGTAATGRIITAAALIVAVVAGAFVFSDLV
FT                   MMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQTRIGLGEIHLPD
FT                   ERKRPVSNGRPARPPVTAGLVAARAAGDPRPPHDPTHPLAESPRPARSSRASSPELTPA
FT                   LEATAAPAAPSGASTTRMQIGSSTEPPTTRLAAAGRSVQSPASTPPPTPTPPSALSAGQ
FT                   TRAMPLAANRSTDAAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGG
FT                   ALSAQDLLRREGRL"
     gtgttcgcct ggtggggtcg aactgtgtac cgctaccggt tcatcgtaat cggggtcatg        60
     gtcgctctat gcctcggcgg cggcgttttc gggctgagcc tcggcaagca cgtcacgcag       120
     agcggcttct acgacgacgg cagccaatcg gtgcaagcat cggtgctggg cgaccaggtc       180
     tacggccgag accgaagcgg tcacatcgtc gcgatcttcc aagccccagc cggcaagacc       240
     gttgacgacc cggcctggtc aaagaaggtc gtcgacgagc tcaaccggtt ccagcaggat       300
     caccccgacc aggtcttggg atgggccggc tacctgagag cgagtcaggc gaccggcatg       360
     gccaccgccg acaagaagta caccttcgtt tccatcccgc tcaagggtga tgacgacgac       420
     accatcctca acaactacaa ggccatcgca cccgacctgc agcggctcga cggaggcacg       480
     gtgaagctcg ccgggctgca accggtggcc gaggcgttga ccggcaccat cgccaccgac       540
     caacggcgaa tggaagtgct ggcgctgccg ttggtggcgg tggtgttgtt cttcgtgttc       600
     ggcggcgtga tcgccgccgg cctaccggtg atggtcggag ggctgtgcat cgccggcgcg       660
     ctgggcatca tgcggttcct cgcgatcttc ggtcccgtgc actatttcgc ccagcccgtg       720
     gtgtcgctga tcggtctggg gatcgccatc gactacgggt tgttcatcgt gagccggttc       780
     cgcgaagaga tcgccgaagg ctacgacacc gagacggcag tacggcgcac ggtgatcacc       840
     gccggacgca cggtgacgtt ctcggcggtg ttgatcgtcg cgtcggcgat cggtctgctg       900
     ctcttcccgc agggtttcct gaagtcgctg acctacgcca cgatcgcatc ggtgatgctg       960
     tcggccatcc tgtctatcac cgtgttgccg gcctgtctgg ggatcctggg caaacacgtc      1020
     gacgcgctcg gcgtgcggac cctgttccgg gtgcccttcc tggcgaactg gaagatttcg      1080
     gccgcctacc tgaactggct cgccgaccgc ctgcagcgga ccaagacccg cgaagaggtc      1140
     gaagccggct tctggggcaa gctggttaac cgggtgatga agcgcccagt gctgttcgcc      1200
     gcaccgatcg tcatcatcat gattttgctg attatcccgg tgggcaagct gtcattgggc      1260
     gggatcagcg agaagtactt gccgccgacc aattcggtgc gccaggcgca ggaggagttc      1320
     gacaaactct tccccggata ccgcaccaat ccgctgacac tggtgatcca gaccagcaac      1380
     catcaaccgg tcaccgacgc gcagatcgct gacatccgca gcaaggcgat ggcgatcggc      1440
     ggattcatcg agccggacaa cgatccggcg aatatgtggc aagagcgtgc ctacgcggta      1500
     ggcgcatcta aagatccatc ggtgcgcgtc ctgcagaacg ggttgatcaa cccggctgac      1560
     gcgtcgaaga agctcaccga gctgcgcgcg atcaccccgc ccaaaggaat cacggtcttg      1620
     gtcggtggaa ctcccgccct ggagctggat tcaatccacg gcctgttcgc gaagatgccg      1680
     ctgatggtgg tcatcctgct gaccaccacg atcgtcttga tgttcttggc gttcggctcg      1740
     gtggtgctgc caatcaaggc gacgctgatg agcgctctga cgctcgggtc caccatgggc      1800
     atcctgacgt ggatattcgt cgacggacac ttttcgaagt ggctgaattt cacgccgacc      1860
     ccgctgacag cgccggtgat cgggctgatc atcgcgctgg tcttcggcct atccaccgac      1920
     tacgaggtgt tcttggtgtc ccggatggtc gaggcgcgag agcgcggcat gtcgacccag      1980
     gaggcgatcc ggatcggcac cgcagccacc ggacgcatca ttaccgccgc ggcgctgatt      2040
     gttgccgtcg tcgcgggcgc gttcgtgttc tccgacctgg tgatgatgaa gtatctggcc      2100
     tttggactga tggcggcgct gctgctggac gcgaccgtgg tgcggatgtt tttagtgcca      2160
     tcggtgatga agctgctcgg cgatgactgc tggtgggcac cgcgctgggc cagacgcctg      2220
     cagacccgca tcgggctggg cgagatccac ctgcccgacg agcgcaagcg gcccgtcagc      2280
     aacgggcgtc ccgcacgtcc tccggtcaca gctgggctgg ttgcggcgcg cgccgctggg      2340
     gacccgcgcc caccgcacga tccgacccat ccgctggcgg agtcacctcg accggcccgc      2400
     tcgagtcgag caagctcacc ggagctcacg cctgccctgg aagcaactgc cgcgccggcg      2460
     gcgccgtctg gggcgagcac cacacggatg cagatcgggt cgtcgacgga gccgccgaca      2520
     acccgcctcg cggctgccgg tcggtccgtg cagtcgccag catccacgcc gccaccaacc      2580
     ccgaccccgc catcggccct gtctgccggt cagacccggg ctatgccgct tgcggcgaac      2640
     cgctccacag acgcagccgg tgacccggcc gaacccaccg cggccctgcc aatcatacgg      2700
     tcggacggcg acgactcaga ggcagccact gagcagctga atgcccgcgg cacgagcgat      2760
     aagacgcgtc agcgccgccg cggcggcggc gccctgtccg cccaggatct gcttcgccgc      2820
     gaaggacgcc tttaa                                                       2835
//

If you have problems or comments...

PBIL Back to PBIL home page