(data stored in ACNUC1104 zone)

EMBL: CP000717.PE211

CP000717.PE211       Location/Qualifiers
FT   CDS_pept        249356..250441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10211"
FT                   /old_locus_tag="TBFG_00208"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0209"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10211"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04554"
FT                   /protein_id="ABR04554.1"
FT                   /translation="MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPG
FT                   VGCRTVARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATRRPVV
FT                   AVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVAALDDLDDTLRAVL
FT                   RALAAHPDGFDALDRAVAGFLAAALPVPTEVRLRLLDTLDLFGIALGMAAFRPGRPSRT
FT                   PAQLRTLLRRVSGVDAVIDKVTAAGSEVRYRRLLDAVAELEALAAQAKEIGGPIGEFLR
FT                   DDDTVLARMAAAVDVALAVGLDVGPLDDPAAHLPRAVRWHRYSLDNGDMHRTCGADIAR
FT                   GSLRLWSLAGGMPLHRYRKSS"
     atgcgcggac aagggcacca gattttcgtc gacgagctgg cgcgattcgc caccagctcc        60
     gccgaccagc gggtagtggc gatcgcgcag cgggccgccg aaccgctgcg cgtagcggtc       120
     cgtgggcgtc ccggggtggg ttgccgcacg gtggcgcgcg ccctgcaggg tgctgggagc       180
     tcgtcgggca tgacggtgac accgcaagca cgcgccgccg actctgacgt cgacctggtc       240
     gtctacgtca ccgtcgaggt agtcaagccc gaggaccgcg aagccatcgc cgccacccgg       300
     cgcccggtgg tggcggtgtt gaacaaggcc gatctggccg gcccgctctc gggtgcaggt       360
     ccgatcgtga tggcgcaggc ccggtgcgcg caattttcta cactcctcgg ggtccccatg       420
     gagtccatga tcgggttgct cgccgtcgcg gcgctcgacg atcttgatga caccttgcgg       480
     gccgtgctgc gggcgctagc cgcccacccc gacggctttg acgctctcga ccgagccgtt       540
     gcggggtttc tggcggcagc cctgccggtc cctaccgagg tacggttgcg gttgctggac       600
     accctcgacc tgttcggcat cgcactgggc atggcagcgt tccggccggg ccggccctcg       660
     cgaaccccgg cgcagctccg caccctgtta cgccgggtca gcggtgtcga cgccgtcatc       720
     gacaaggtca ccgccgccgg ttctgaggtg cgctaccggc ggttgcttga cgcggtcgcg       780
     gagctggagg cgctggccgc gcaggccaag gagatcggcg gtccgatcgg tgagttcttg       840
     cgcgacgacg acacagttct cgcccggatg gcggccgccg tcgacgtagc cctggccgtc       900
     gggctagacg ttggcccgtt ggacgatccg gccgcccacc tgccgcgggc ggtgcggtgg       960
     catcgttaca gcctggacaa cggtgacatg caccgcacgt gcggcgcgga tatcgctcgg      1020
     ggatcccttc ggctgtggtc gctggccggc ggcatgcccc tgcaccgata ccggaagtca      1080
     tcgtga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page