(data stored in ACNUC1104 zone)

EMBL: CP000717.PE214

CP000717.PE214       Location/Qualifiers
FT   CDS_pept        complement(253987..254958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10214"
FT                   /old_locus_tag="TBFG_00211"
FT                   /product="transcriptional regulatory protein, asnC-family
FT                   nadR"
FT                   /note="Mapped to H37Rv Rv0212c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10214"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04557"
FT                   /protein_id="ABR04557.1"
FT                   /translation="MTHGMVLGKFMPPHAGHVYLCEFARRWVDELTIVVGSTAAEPIPG
FT                   AQRVAWMRELFPFDRVVHLANENPQRPWEHPDFWDIWKASLQGVLATRPDFVFGAEPYN
FT                   ADFAQVLGARFVAVDHGRTVVPVTATDIRADPLGHWQHIPRCVRPAFVKRVSIIGPEST
FT                   GKTTLAQAVAEKLRTKWVPERAKMLRELNGGSLIGLEWAEIVRGQIASEEALARDADRV
FT                   LICDTDPLATTVWAEFLAGGCPQELRDLARRPYDLTLLTTPDVPWDADDGRCVPGARGT
FT                   FFARCEQALRAAGRSFVVITGGWEERLSVSLRAVEELVRARR"
     gtgacacacg gaatggtgct cggcaagttc atgccgcccc atgcgggaca cgtctacctt        60
     tgcgagttcg cgcggcgatg ggtggatgag ctgaccatcg tcgtcggatc aacggcagca       120
     gagccgattc cgggcgccca gcgcgttgca tggatgcggg agctgttccc cttcgatcgc       180
     gtggtccatc tggccaacga gaacccgcag cgcccgtggg agcacccgga cttctgggac       240
     atctggaagg cgagcctgca gggcgtgctg gcaacccgcc ccgacttcgt cttcggtgcc       300
     gagccctaca acgcggactt tgcccaggtc ctcggagcgc gtttcgtggc ggtcgatcac       360
     ggtcgcaccg tcgttcccgt gactgcaacc gacatccgcg cggacccgct tggccactgg       420
     caacacatcc cacggtgcgt gcggccggcc ttcgtcaaac gcgtgagcat catcggaccc       480
     gaatccaccg ggaagaccac gctggcacag gcggttgcgg aaaagctccg aacgaagtgg       540
     gtcccggagc gggcgaaaat gttgcgggag ctcaatggcg gctcactgat aggactggag       600
     tgggccgaaa tcgttcgcgg acagatcgcg tcggaggaag ccttggctcg tgacgccgat       660
     cgcgtcctga tctgcgacac ggatccgctc gcgacgaccg tgtgggccga gttcctggcg       720
     ggcggctgcc cgcaagagct ccgtgatcta gctcggcgtc cctacgatct cacactgctc       780
     accacgcccg atgtgccctg ggacgccgac gacggacgct gtgtccccgg cgcacgcggt       840
     acctttttcg cccgctgcga gcaggctctc cgcgccgcgg gacgatcatt cgtggtgatc       900
     acgggcggtt gggaagagag gctttcggtg tctttgcgcg ctgtcgaaga acttgtgcgt       960
     gcccgccgct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page