(data stored in ACNUC1104 zone)

EMBL: CP000717.PE218

CP000717.PE218       Location/Qualifiers
FT   CDS_pept        259231..260244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10218"
FT                   /old_locus_tag="TBFG_00215"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0216"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04561"
FT                   /protein_id="ABR04561.1"
FT                   /translation="MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVG
FT                   NRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPA
FT                   VGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWK
FT                   PGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSG
FT                   APELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTA
FT                   PVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF"
     gtggctagcg ggtatggggg catccgcgtc ggcgggccct atttcgatga cctgtcaaaa        60
     ggtcaggtgt tcgactgggc gccgggggtc acactgtcgc tggggctggc ggccgcccat       120
     cagtcgatcg tgggtaaccg gctacgcctg gctctggact ccgacctgtg tgcggcggtg       180
     acgggtatgc cggggccgct ggcgcatccg ggcctggttt gcgatgtggc gatcggccag       240
     tcaactttgg cgactcagcg ggtcaaagcc aacctgttct accgcgggct caggtttcac       300
     cgatttccgg cagtgggcga caccctctac acccgtaccg aggtggtggg gctgcgagcc       360
     aactcgccca aaccgggccg tgcgccaacc ggattggcgg ggctgcggat gaccacgatc       420
     gaccggaccg atcggttggt gctcgatttc taccggtgcg ccatgctgcc cgccagcccc       480
     gattggaaac ccggcgctgt gccaggtgac gacttgtcca ggatcggtgc cgacgcgccg       540
     gcgccggccg ccgatccaac cgcacactgg gacggtgcgg ttttccgaaa gcgggttccc       600
     gggccgcact tcgatgccgg tattgccggt gcggtgttgc atagcaccgc agacctggtc       660
     agtggagcgc cggagctggc tcggctcacc ctcaatatcg ctgctacgca ccatgattgg       720
     cgggtcagcg gacgacggct ggtctacggc gggcatacca tcggactggc actcgcgcag       780
     gcaacccggc tattgcctaa cctggcgacc gtcctggact gggaatcctg cgaccacacc       840
     gctccggtac acgagggcga caccctctac agcgagctgc atatcgagtc tgcgcaggcc       900
     cacgcagacg ggggtgtgct gggactgcgg tcactggtct acgcggtcag cgattcggcg       960
     agtgagcccg atcggcaggt gctcgactgg cgttttagcg ccttgcaatt ctag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page