(data stored in ACNUC1104 zone)

EMBL: CP000717.PE22

CP000717.PE22        Location/Qualifiers
FT   CDS_pept        complement(27124..27543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10022"
FT                   /old_locus_tag="TBFG_00022"
FT                   /product="transcriptional regulatory protein whib-like
FT                   whiB5"
FT                   /note="Mapped to H37Rv Rv0022c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04365"
FT                   /protein_id="ABR04365.1"
FT                   /translation="MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRC
FT                   PLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLP
FT                   DNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA"
     atggcacacc cctgcgcaac cgacccggaa ctatggttcg ggtaccccga tgacgacggc        60
     agcgacggcg ccgctaaggc acgcgcctat gagcggtcgg ccacccaagc gcggatccaa       120
     tgcctgcgcc ggtgcccgct cctacagcag cgccggtgtg ctcaacacgc ggtcgagcat       180
     cgggtggagt acggcgtatg ggccggcatc aagcttcccg gcggccagta ccgaaagcgc       240
     gaacagctcg cggcagccca cgacgtgctg cgtcggattg ccggcggcga gatcaattcc       300
     aggcagctcc cggacaatgc ggctctgctg gcccgcaacg aaggactcga ggtcaccccg       360
     gtgcccgggg tcgtggtgca cctgccgatc gcacaggttg gcccacaacc ggccgcttga       420
//

If you have problems or comments...

PBIL Back to PBIL home page