(data stored in ACNUC1104 zone)

EMBL: CP000717.PE221

CP000717.PE221       Location/Qualifiers
FT   CDS_pept        262572..263120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10221"
FT                   /old_locus_tag="TBFG_00218"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0219"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10221"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04564"
FT                   /protein_id="ABR04564.1"
FT                   /translation="MFDIATRFKNSYGSGPLHLLAMVSGFALLGYIVATARPSALWNQA
FT                   TWWQSIAVWFVAAVVAHDLLLYPLYALADRILARLVGRRDVSAPRRRPELPVRNYIRIP
FT                   ALAAGLTLLVFLPGIIRQGAPTYLDATGQTQEPFLGRWLLLTAVAFGISAAAYAIRLVV
FT                   AHVRRRRAGCSRVDAIDEE"
     atgttcgaca ttgcaacgcg tttcaaaaac tcctacgggt caggtccatt gcacctgctg        60
     gcgatggtgt ctggcttcgc cctgctgggc tacatcgtgg ccaccgccag gccctcggcg       120
     ctgtggaacc aggccacctg gtggcagtcg atcgcggtct ggtttgtcgc cgccgtcgta       180
     gcccacgacc tgctgttgta cccgctctac gcgctggccg accggatcct ggccaggcta       240
     gtcggcaggc gcgacgtctc ggcgccccgc cgccgcccgg aactaccggt acgcaactac       300
     attcggatcc cggcgctggc agccggcttg acgctgctgg ttttcctgcc cggcatcatc       360
     agacagggtg cgccgacata cctggatgcg accggacaga cgcaggaacc atttctgggc       420
     aggtggttgc tgctcaccgc ggtcgcgttc gggatcagcg cggccgctta cgccattcgg       480
     ctggtggtgg cgcacgtgag gcggcgccga gcggggtgtt cgcgggtcga cgcgatcgac       540
     gaggagtag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page