(data stored in ACNUC1104 zone)

EMBL: CP000717.PE227

CP000717.PE227       Location/Qualifiers
FT   CDS_pept        268981..270135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10227"
FT                   /old_locus_tag="TBFG_00224"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0225"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10227"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04570"
FT                   /protein_id="ABR04570.1"
FT                   /translation="MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRT
FT                   ARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGW
FT                   PFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPS
FT                   ARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVA
FT                   ELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLL
FT                   PSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSD
FT                   SVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV"
     atgtctgctc tgcgctcggt gttgctgctg tgctggcgcg acatcgggca cccccagggg        60
     ggcgggagcg aagcctatct gcaacgcatc ggggctcagt tggccgcatc gggcattgca       120
     gtcacgttgc gcaccgctcg ctatcccggt gcgccacggc atgaactggt cgacggggtg       180
     cggatcagtc gtgccggcgg gcgctactcg gtgtatctat gggcgttgct ggcgatggcc       240
     gcagcccgat gtgggcttgg gccgctgcgc cgagtgcgcc cggatgtggt cgtcgatacc       300
     caaaacggct ggccgtttgt ggcccggctg ttgtatggcc ggcggtcgct ggtactggta       360
     caccattgcc accgtgagca gtggccggtg gccgggcgga tgatgggtcg gctcggctgg       420
     tatgtcgagt cgatgttgtc gccacggcta caccggcgca accagtacgt gacggtgtcg       480
     ctgccgtcgg cgcgggatct gatcgccctc ggtgtggaca gcgagcggat cgctgtggtg       540
     cgcaacggcc tcgacgaggc gccgtcgcca acgttgtccg gcccacgtgc gcccacgccg       600
     cgtgtggtgg tgctctcccg gctggtgccg cacaagcaga tcgaggacgc gttggcagcg       660
     gtcgcggagc tacagcctcg gataccgggc ctgcacctag acatcgtcgg cggtggctgg       720
     tggcggcagc gcctcgttga ccatgtgcac cggctcgaca ttgctgacgc cgttaccttt       780
     cacgggcatg tcgacgatgt gaccaaacac catgtgctgc aaagctcctg ggtgcacttg       840
     ttgccctcac gtaaagaggg atgggggctc gcggtcatcg aggcggccca gcacggcgtg       900
     cccaccatcg ggtacagatc ctccggtggt ttggcggact cgatcgtcga cggggtgacc       960
     ggcatattgg tcgacgaccg ggccgaattg gtggcttggc tcgaacaact gctgtccgat      1020
     tcggtgctgc gtgaccaact cggcgccaag gcacaggcgc gtagcggtga gttctcctgg      1080
     cggcaaagcg ccgaagcgct gcgcagcgtg ttggaggcag tgcaggccag ccgttttgtc      1140
     agcggcgtgg tttga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page