(data stored in ACNUC1104 zone)

EMBL: CP000717.PE231

CP000717.PE231       Location/Qualifiers
FT   CDS_pept        complement(274624..275304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10231"
FT                   /old_locus_tag="TBFG_00228"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0229c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04574"
FT                   /protein_id="ABR04574.1"
FT                   /translation="MRQPRRANAMGLALCIYIGSLLIYTPIHGETSRRHRRAGFKHGSY
FT                   RIGHDDDQRHRQRGPAASHVSASSTRRRRSRHAGRRTARGPRRSMALKYLLDTSVIKRL
FT                   SRPAVRRAVEPLAEAGAVARTQITDLEVGYSARNETEWQRLMVALSAFDLIESTASHHR
FT                   RALGIQRLLAARSQRGRKIPDLLIAAAGEEHGLVVLHYDADFDLIAAVTGQPCQWIVPA
FT                   GTID"
     gtgagacagc cgcgccgggc gaatgccatg ggcttggcat tgtgcatata tatcggctcc        60
     ttattgatat atactccgat tcatggcgaa acatctcgtc gacatcgacg agcaggcttt       120
     aaacatggct cgtacagaat tgggcacgac gacgatcaaa gacaccgtca acgcggccct       180
     gcggcaagcc acgtctcagc gagttcaacg cgtcgccgcc gctctcgaca cgctggccgc       240
     cgcaccgcca gaggaccgcg ccgaagcatg gcgctgaaat atcttctcga caccagcgtg       300
     atcaaaaggc tcagccggcc cgccgtgcgg cgggcggtgg aaccgttggc tgaggccggt       360
     gccgtcgctc gcacgcaaat aaccgacctt gaagtcgggt actccgcacg caatgagacc       420
     gagtggcagc ggctcatggt ggcattgagc gcgttcgacc tcatcgaatc gacggcatcg       480
     catcatcgcc gcgcgcttgg aatccagcgc ctactcgctg cgcgtagtca gcgcggtcgc       540
     aaaatcccgg acctgctcat tgccgcggcc ggcgaggaac acgggctggt cgttctacat       600
     tacgacgcgg acttcgatct catcgccgcc gtgaccggtc agccctgtca gtggatcgtg       660
     ccagcgggca cgatcgacta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page