(data stored in ACNUC1104 zone)

EMBL: CP000717.PE241

CP000717.PE241       Location/Qualifiers
FT   CDS_pept        288746..289360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10241"
FT                   /old_locus_tag="TBFG_00238"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0238"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10241"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04584"
FT                   /protein_id="ABR04584.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLNREMSRFIDALRSSINFDQSPKDLLRNTIVSFLRYIDANR
FT                   ASWIVMYTQATSSQAFAHTVREGREQIVQLVAELVRAGTRGPLTDAEIEMMAVALVGAG
FT                   EAVATRLGIGDTDVDEAAEMMINLFWLGLKGAPVDRLETGH"
     atggcaggtg gtaccaagcg actaccgcgt gctgtccgag agcagcagat gctcgatgcc        60
     gccgtgcaga tgttctcggt taacggctac cacgagacct cgatggacgc gatcgctgcc       120
     gaggcgcaga tctccaagcc gatgctgtac ctgtactacg gctccaagga agacctgttc       180
     ggcgcctgcc tgaaccgtga gatgagccgg ttcatcgacg cgttgcgttc cagcatcaac       240
     ttcgaccaga gcccgaaaga cttgctgcgc aacaccatcg tgtcgttcct acgctatatc       300
     gatgccaacc gggcgtcgtg gatcgtgatg tacacccagg ccaccagctc ccaagcgttc       360
     gcgcacacgg tgcgtgaggg gcgcgaacag atcgtccaac tggtggccga gttggtgcgg       420
     gccggcaccc gcggcccgct tacggacgcc gaaatcgaga tgatggccgt cgcgctggtg       480
     ggcgccggcg aggcagtggc cacccggctc ggtatcggtg acaccgacgt tgacgaggcg       540
     gccgagatga tgatcaacct gttctggctc ggcctcaagg gcgcgccggt ggatcggctc       600
     gagaccgggc actga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page