(data stored in ACNUC1104 zone)

EMBL: CP000717.PE245

CP000717.PE245       Location/Qualifiers
FT   CDS_pept        complement(290983..292347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10245"
FT                   /old_locus_tag="TBFG_00242"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase fabG4"
FT                   /note="Mapped to H37Rv Rv0242c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10245"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04588"
FT                   /protein_id="ABR04588.1"
FT                   /translation="MAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLT
FT                   GSLLIGGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLKGLHE
FT                   FFTPVLRNLGRCGRVVVVGGTPEAAASTNERIAQRALEGFTRSLGKELRRGATTALVYL
FT                   SPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADDSTPPADWEKPLDGKVAIVTGAA
FT                   RGIGATIAEVFARDGAHVVAIDVESAAENLAETASKVGGTALWLDVTADDAVDKISEHL
FT                   RDHHGGKADILVNNAGITRDKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGG
FT                   RVIGLSSIAGIAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTA
FT                   AIPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQAMIGA"
     gtggctccca agcgttcgtc cgatctgttc tcgcaggttg tcaactccgg tccaggatcg        60
     tttttggcca ggcaattggg tgttccgcaa cccgagacgc ttcgccgcta tcgagcaggc       120
     gaaccgccac tgaccgggtc gctgctgatc ggcggggccg gcagggtcgt cgaaccactg       180
     cgcgcggcac tcgaaaagga ctacgacctg gtaggaaaca acctgggcgg gcgctgggcg       240
     gactcgttcg gcgggctggt cttcgacgcc accggcatca cagagccggc cgggctcaag       300
     gggctgcacg agttctttac tccggtactg cgcaatctcg gccgttgcgg gcgcgtggtg       360
     gttgttggcg gcacacccga agcggccgcc agcacgaacg agcggatcgc gcagcgcgcg       420
     ctggagggct tcacccgctc gctgggcaag gaactgcgcc gcggtgcgac aacggcgttg       480
     gtctacctgt cgccggacgc caagcccgca gctaccggcc tcgagtcgac catgcgattc       540
     ctgctgtcgg ccaagtcggc ctacgtcgac ggccaagtct tctctgtcgg ggcggacgat       600
     tccacaccgc cggccgactg ggagaagccg ctggacggca aggtcgccat tgtgaccggc       660
     gcggcccgcg gcatcggcgc aaccatcgcc gaggtgttcg ctcgcgacgg cgcccacgtg       720
     gtcgccatcg atgtggagtc cgccgccgag aacctggccg aaaccgccag caaggtgggc       780
     ggcaccgcgc tgtggctcga cgtcaccgcc gacgatgccg tcgacaagat cagcgagcac       840
     ctgcgcgacc accacggtgg caaggccgac atcctggtca acaacgccgg catcacccgt       900
     gacaagctgc tggccaacat ggacgatgcg cgttgggacg ccgtcctggc tgtcaatctg       960
     cttgccccgt tgcggctcac cgagggtctg gtgggcaacg gcagcatcgg agagggtggt      1020
     cgggtgatcg ggctgtcgtc gatcgccggc atcgccggca accgcggcca gaccaactac      1080
     gccaccacca aggccgggat gatcggcatc acccaggcgc tggcacccgg cctggccgcg      1140
     aaaggcatca cgatcaacgc cgtggcaccg ggattcatcg aaacccagat gacggccgcc      1200
     atcccgctgg ccacccgtga ggtaggccgc cggctgaact cgctgctgca gggcgggcag      1260
     cccgtcgacg tcgccgaggc catcgcctac ttcgccagcc cggcgtcaaa cgcggtgacc      1320
     ggcaacgtca ttcgtgtctg cggccaggcc atgatcggcg cgtga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page