(data stored in ACNUC1104 zone)

EMBL: CP000717.PE251

CP000717.PE251       Location/Qualifiers
FT   CDS_pept        complement(299180..301120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10251"
FT                   /old_locus_tag="TBFG_00248"
FT                   /product="hypothetical succinate dehydrogenase iron-sulfur
FT                   subunit (succinic dehydrogenase)"
FT                   /note="Mapped to H37Rv Rv0248c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04594"
FT                   /protein_id="ABR04594.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYE
FT                   ARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNS
FT                   WEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENS
FT                   RFMFDYIPPVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTP
FT                   HGGVYLDIASRLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDAD
FT                   TGAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSA
FT                   EAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAE
FT                   LWSRYHNVLVEGHRQYNPGWNLSIDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMD
FT                   PNWRRILLVCRATETMGTGGSGSGDSNCHINVTQQLQTPMRPDLLELFEISELEKYYTD
FT                   EELAEHPGRRG"
     atggttgagg tcgagcggca ctcctacgac gtagtcgtga tcggtgccgg cggcgcgggg        60
     ttacgcgcgg tcatcgaggc gcgggaacgc ggcttgaaag tagccgtcgt gtgcaaatcc       120
     ctattcggca aggcccacac ggtcatggcc gaaggcggct gcgcggccgc gatgggcaac       180
     gccaacccga aggacaattg gaagactcac ttcggcgaca cgatgcgcgg tggaaagttc       240
     ctgaacaact ggcgtatggc cgagctgcac gccaaggagg cgccggaccg ggtctgggag       300
     ttggagacct acggcgcgct gttcgaccgc accgacgatg gccgaatcag tcagcgcaac       360
     ttcggcggac acacctatcc gcgactggcg cacgtcggcg accgcaccgg cctggagttg       420
     atccgcaccc tgcagcaaaa ggttgtctcg ctgcagcagg aggaccacgc cgagctcggc       480
     gactacgaag cgcggatcaa agtgttcgcc gaatgcacca tcaccgaact gctcaaggac       540
     caaggcgcga tcgccggagc cttcggctac tggcgggaaa gcggccggtt catcgtgttc       600
     gaggcgccag cggtggtgct tgccactggc gggatcggca agtcgttcaa ggtgacatcc       660
     aactcctggg agtacaccgg agacgggcac gcgttggcac tgcgggccgg ggcgacgctg       720
     atcaacatgg agttcgtcca gttccacccg acgggcatgg tgtggccgcc cagtgtcaag       780
     ggaattctgg tcactgaggg tgttcgcggc gacggcggag tgctcaaaaa ctcggagaac       840
     tctcgcttca tgttcgacta cattccgccg gtgttcaagg gccagtacgc cgagacggag       900
     gaagaggccg accagtggct taaggacaac gactcggccc gacgcacccc ggacttgctg       960
     ccccgcgacg aggtcgcgcg cgcgatcaac tcagaggtca aggccggccg cggtaccccg      1020
     cacggcggcg tctacctcga catcgcatcc cggctgacac ccgccgagat caaacggcga      1080
     ttgccgtcga tgtatcacca gttcaaagag ctcgctgaag tcgatatcac aacgcaggca      1140
     atggaagtcg ggccgacgtg tcactacgtg atgggcggtg tcgaagtaga cgcggacacc      1200
     ggcgccgcca cggtgccagg cctgttcgct gccggtgagt gtgccggcgg tatgcacggc      1260
     tccaaccggc tgggcggcaa ttcgctgtcc gatctgctgg tattcggccg gcgggccggc      1320
     ctgggcgcag cggattacgt acgggcactg agcagccggc cagcggtttc agcggaggct      1380
     atcgatgcgg cggcccagca ggcgctgagc cccttcgaag gaccgaaaga cggctcggcg      1440
     ccggagaatc cgtacgcgct gcatatggac ttgcagtacg tgatgaacga tctggtcggt      1500
     atcatccgca acgccgacga aatatccagg gcgctgactc ttttggccga gctgtggtcg      1560
     cgctaccaca acgtactcgt cgaaggtcac cgtcaataca atccgggctg gaacctgtcc      1620
     atcgacctgc gcaacatgtt gctggtcagc gagtgcgtgg ccagagctgc gctacagcgc      1680
     accgaaagcc gaggcggcca cacccgagac gaccatcccg gtatggaccc caactggcgc      1740
     aggatcttgc tggtatgccg ggccaccgaa accatgggca ccggtggcag cgggtccggc      1800
     gactccaact gccacatcaa cgtcacccag cagctgcaaa cgcccatgcg acccgacttg      1860
     ctggagctct tcgagatctc ggagttggag aaatactaca ccgacgaaga gctggccgag      1920
     catccaggac ggagaggcta a                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page